|
||||||
|
UniGene Name: sp_v3.0_unigene62549
Length: 232 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene62549
C |
|
Ace file of the UniGene sp_v3.0_unigene62549
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis thaliana] sp|C0LGH8.1|Y1634_ARATH RecName: Full=Probable LRR receptor-like serine/threonine-protein kinase At1g63430; Flags: Precursor gb|ACN59263.1| leucine-rich repeat receptor-like | - | - | 2.0e-18 | 61% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 90% |
| Source | Gene names |
|---|---|
| Sma3 | AT1G63430; AT5G41180; At1g63430/F2K11_18; At5g41180; At5g41180/MEE6_25; GSVIVT00000392001; GSVIVT00024049001; GSVIVT00029339001; H0306F12.6; LRR-RLK; OsI_17977; OsJ_16675; PHYPADRAFT_137205; PHYPADRAFT_145616; PHYPADRAFT_173940; PHYPADRAFT_177225; POPTRDR |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | protein disulfide oxidoreductase activity | GO:0015035 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | cell redox homeostasis | GO:0045454 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
| Sma3 | Glutaredoxin | IPR002109 | - | 0.0 | - |
| Sma3 | IPR012335 | - | 0.0 | - | |
| Sma3 | Leucine-rich repeat-containing N-terminal, type 2 | IPR013210 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G63430.2 | Leucine-rich repeat protein kinase family protein chr1:23522896-23526451 FORWARD LENGTH=688 | 2.0e-23 | 61% |
| RefSeq | Arabidopsis thaliana | NP_176532.2 | putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis thaliana] | 2.0e-23 | 61% |
| RefSeq | Populus trichocarpa | XP_002304486.1 | predicted protein [Populus trichocarpa] | 2.0e-24 | 66% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLZ2
Fln msg: Distance to subject end: 91 aas, your sequence is shorter than subject: 77 - 514
Fln protein:
N
Protein Length:
78
Fln nts:
C
Fln Alignment:
G5KS2UX02FK49Z___NGVPLMSREELEAACEDFSNVIGSSPDSMVYKGITSQGTEIAVTSMRFAREDWTTQLELYVQRKVADLAKLNHRNIV
B8LLZ2_______________NGVPVMSRAELETACEDFSNVIGSSPDSMVYKGIISQGTEIAVTSMRFAREDWTTHLEIYFQRKVADLAKLNHRNIV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
