SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene62492

Length: 230 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v3.0_unigene62492
GCTATCCTAATTGCCATTATTGGTCTGGTTCATTTGCGCTTCTTATCGGCAACATGCAGACCTATCTACAATCAATAACAATCAAGCTGGAACAATGGAGAATCAAACAGATGGATACTGAGGAATGGATGCAGCACCGCCAACTACCTCCTGAACTAAGTGAGCGAATCCGGCGATATAATCAGTACAAGTGGGTTGCAACTCGTGGAGTTGATGAGAAATCTAACATT

Ace file of the UniGene sp_v3.0_unigene62492 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	cyclic nucleotide and calmodulin-regulated ion channel-like protein [Arabidopsis thaliana]	-	-	6.0e-23	74%
FL-Next	sp=Putative cyclic nucleotide-gated ion channel 15; Arabidopsis thaliana (Mouse-ear cress).	-	-	0.0	71%
Sma3	Cyclic nucleotide-gated ion channel, putative	-	-	5.841e-23	-

Source	Gene names
Sma3	ACBK1; AT5G57940; At1g01340; At1g15990; At1g19780; At2g23980; At2g24610; At2g28260; At2g46430; At3g48010; At4g01010; At4g30360; At4g30560; At5g14870; At5g53130; At5g57940; CBP4; CBP7; CBT1; CNGC-C; CNGC1; CNGC10; CNGC13; CNGC14; CNGC15; CNGC16; CNGC17; CN

Source	GOs	Term	Type	Identity
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	apical plasma membrane	GO:0016324	Cellular Component	-
Sma3	ion channel activity	GO:0005216	Molecular Function	-
Sma3	intracellular cyclic nucleotide activated cation channel activity	GO:0005221	Molecular Function	-
Sma3	voltage-gated potassium channel activity	GO:0005249	Molecular Function	-
Sma3	calmodulin binding	GO:0005516	Molecular Function	-
Sma3	cAMP binding	GO:0030552	Molecular Function	-
Sma3	cGMP binding	GO:0030553	Molecular Function	-
Sma3	ion transport	GO:0006811	Biological Process	-
Sma3	potassium ion transport	GO:0006813	Biological Process	-
Sma3	calcium ion transport	GO:0006816	Biological Process	-
Sma3	cellular calcium ion homeostasis	GO:0006874	Biological Process	-
Sma3	pollen tube growth	GO:0009860	Biological Process	-
Sma3	response to cadmium ion	GO:0046686	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	IQ motif, EF-hand binding site	IPR000048	-	-
Sma3	Cyclic nucleotide-binding domain	IPR000595	-	-
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	Potassium channel, voltage-dependent, EAG/ELK/ERG	IPR003938	-	-
Sma3	Ion transport	IPR005821	-	-
Sma3	RmlC-like jelly roll fold	IPR014710	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3		IPR017442	-	-
Sma3	Cyclic nucleotide-binding, conserved site	IPR018488	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT2G28260.1	ATCNGC15, CNGC15 cyclic nucleotide-gated channel 15 chr2:12049989-12052453 FORWARD LENGTH=678	6.0e-29	71%
RefSeq	Arabidopsis thaliana	NP_180393.1	cyclic nucleotide-gated channel 15 [Arabidopsis thaliana]	7.0e-29	71%
RefSeq	Populus trichocarpa	XP_002331696.1	predicted protein [Populus trichocarpa]	2.0e-28	73%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: sp_plants

Fln subject: Q9SL29

Fln msg: Distance to subject end: 232 aas, your sequence is shorter than subject: 76 - 678

Fln protein: YPNCHYWSGSFALLIGNMQTYLQSITIKLEQWRIKQMDTEEWMQHRQLPPELSERIRRYNQYKWVATRGVDEKSNI

Protein Length: 77

Fln nts: GCTATCCTAATTGCCATTATTGGTCTGGTTCATTTGCGCTTCTTATCGGCAACATGCAGACCTATCTACAATCAATAACAATCAAGCTGGAACAATGGAGAATCAAACAGATGGATACTGAGGAATGGATGCAGCACCGCCAACTACCTCCTGAACTAAGTGAGCGAATCCGGCGATATAATCAGTACAAGTGGGTTGCAACTCGTGGAGTTGATGAGAAATCTAACATT

Fln Alignment:

G5KS2UX02HR1JS___FALLIGNMQTYLQSITIKLEQWRIKQMDTEEWMQHRQLPPELSERIRRYNQYKWVATRGVDEKS
Q9SL29_______________FALLIGNMQTYLQSTTMRLEEWRIRRTDTEQWMHHRQLPPELRQAVRKYDQYKWLATRGVDEEA

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain