UniGene Name: sp_v3.0_unigene62487
Length: 236 nt
UniGene Fasta |
---|
>sp_v3.0_unigene62487
A |
Ace file of the UniGene sp_v3.0_unigene62487 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Prephenate dehydratase n=1 Tax=Ipomoea trifida RepID=Q6JJ29_IPOTF | - | - | 1.0e-13 | 100% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 94% |
Sma3 | Arogenate/prephenate dehydratase | - | - | 4.482e-19 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Prephenate dehydratase. | EC:4.2.1.51 | - | 1.921e-28 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phenylalanine, tyrosine and tryptophan biosynthesis | 00400 | 1.921e-28 | % | |
Sma3 | Biosynthesis of phenylpropanoids | 01061 | 1.921e-28 | % | |
Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 1.921e-28 | % | |
Sma3 | Metabolic pathways | 01100 | 1.921e-28 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.921e-28 | % | |
Sma3 | Arogenate dehydratase. | EC:4.2.1.91 | - | 9.524e-23 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phenylalanine, tyrosine and tryptophan biosynthesis | 00400 | 9.524e-23 | % | |
Sma3 | Biosynthesis of phenylpropanoids | 01061 | 9.524e-23 | % | |
Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 9.524e-23 | % | |
Sma3 | Biosynthesis of plant hormones | 01070 | 9.524e-23 | % | |
Sma3 | Metabolic pathways | 01100 | 9.524e-23 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 9.524e-23 | % |
Source | Gene names |
---|---|
Sma3 | ADT1; ADT2; ADT3; ADT4; ADT5; ADT6; At1g08250; At1g11790; At2g27820; At3g07630; At3g44720; At5g22630; CHLREDRAFT_196330; F15K20.8; F25C20.4; GSVIVT00010981001; GSVIVT00022086001; GSVIVT00024469001; GSVIVT00025888001; LOC_Os03g17730; MDJ22.5; MICPUCDRAFT_1 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | prephenate dehydratase activity | GO:0004664 | Molecular Function | 0.0 | - |
Sma3 | amino acid binding | GO:0016597 | Molecular Function | 0.0 | - |
Sma3 | arogenate dehydratase activity | GO:0047769 | Molecular Function | 0.0 | - |
Sma3 | L-phenylalanine biosynthetic process | GO:0009094 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Prephenate dehydratase | IPR001086 | - | 0.0 | - |
Sma3 | Amino acid-binding ACT | IPR002912 | - | 0.0 | - |
Sma3 | Prephenate dehydratase, conserved site | IPR018528 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G08250.1 | ADT6 arogenate dehydratase 6 chr1:2588994-2590235 REVERSE LENGTH=413 | 1.0e-18 | 100% |
RefSeq | Arabidopsis thaliana | NP_563809.1 | arogenate dehydratase 6 [Arabidopsis thaliana] | 2.0e-18 | 100% |
RefSeq | Populus trichocarpa | XP_002328073.1 | arogenate/prephenate dehydratase [Populus trichocarpa] | 2.0e-18 | 100% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLZ1
Fln msg: Distance to subject end: 237 aas, your sequence is shorter than subject: 78 - 441
Fln protein:
N
Protein Length:
79
Fln nts:
A
Fln Alignment:
G5KS2UX02F2TKP___IEAVYTMRSGSENLQQSSNVTSTQWQTSCAILSSNVVSQ
B8LLZ1_______________IEAVYTMRSGTENLQQSSNATSTQWQTSCAILSSNVVSQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain