UniGene Name: sp_v3.0_unigene62481
Length: 157 nt
![]() |
---|
>sp_v3.0_unigene62481
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | 1-deoxy-D-xylulose 5-phosphate reductoisomerase n=3 Tax=Pinaceae RepID=C6ZG57_PINTA | - | - | 1.0e-07 | 100% |
FL-Next | tr=1-deoxy-D-xylulose 5-phosphate reductoisomerase; Pinus taeda (Loblolly pine). | - | - | 0.0 | 100% |
Sma3 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase | - | - | 4.167e-24 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase. | EC:1.1.1.267 | - | 4.327e-37 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Terpenoid backbone biosynthesis | 00900 | 4.327e-37 | % | |
Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 4.327e-37 | % | |
Sma3 | Biosynthesis of alkaloids derived from terpenoid and polyketide | 01066 | 4.327e-37 | % | |
Sma3 | Biosynthesis of plant hormones | 01070 | 4.327e-37 | % | |
Sma3 | Metabolic pathways | 01100 | 4.327e-37 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 4.327e-37 | % |
Source | Gene names |
---|---|
Sma3 | At5g62790; DXR; DXR2; GSVIVT00016085001; HbDXR; MQB2.11; Os01g0106900; OsI_00059; OsJ_00058; POPTRDRAFT_728585; POPTRDRAFT_733324; RCOM_1510580; dxr; ptxa_dxr; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | plastid | GO:0009536 | Cellular Component | 0.0 | - |
Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
Sma3 | isomerase activity | GO:0016853 | Molecular Function | 0.0 | - |
Sma3 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase activity | GO:0030604 | Molecular Function | 0.0 | - |
Sma3 | metal ion binding | GO:0046872 | Molecular Function | 0.0 | - |
Sma3 | isoprenoid biosynthetic process | GO:0008299 | Biological Process | 0.0 | - |
Sma3 | isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway | GO:0019288 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | 1-deoxy-D-xylulose 5-phosphate reductoisomerase | IPR003821 | - | 0.0 | - |
Sma3 | 1-deoxy-D-xylulose 5-phosphate reductoisomerase, N-terminal | IPR013512 | - | 0.0 | - |
Sma3 | 1-deoxy-D-xylulose 5-phosphate reductoisomerase, C-terminal | IPR013644 | - | 0.0 | - |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C6ZG57
Fln msg: ERROR#3, very serious frame error, Warning!, your query overlaps and the subject is separated, Distance to subject end: 49 aas, your sequence is shorter than subject: 52 - 479
Fln protein:
V
Protein Length:
53
Fln nts:
G
Fln Alignment:
G5KS2UX02IHPSA___VWDGPKPFSVVGSTGSIGTQTLDIVAExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKALFCCWFYRLNRNSDIGHCRRTMTGVLSAANEKAVELFIDERISYL
C6ZG57_______________VWDGPKPFSVVGSTGSIGTQTLDIVAExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKAPDCVKYPSMDLAYSAGRAGGTMTGVLSAANEKAVELFIDERISYL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain