UniGene Name: sp_v3.0_unigene62377
Length: 205 nt
![]() |
---|
>sp_v3.0_unigene62377
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | 40S ribosomal protein S3-1 [Arabidopsis thaliana] sp|Q9SIP7.1|RS31_ARATH RecName: Full=40S ribosomal protein S3-1 gb|AAK55690.1|AF378887_1 At2g31610/T9H9.13 [Arabidopsis thaliana] gb|AAD24852.1| 40S ribosomal protein; contains C-terminal domain [Arabidops | - | - | 4.0e-27 | 95% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 98% |
Sma3 | 40S ribosomal protein S3 | - | - | 7.117e-11 | - |
Source | Gene names |
---|---|
Sma3 | AT5G35530; At2g31610; At3g53870; At5g35530; CHLREDRAFT_134051; F5K20_170; GSVIVT00016476001; GSVIVT00020378001; GSVIVT00032258001; GSVIVT00034104001; LOC_Os03g38000; MICPUCDRAFT_26239; MICPUN_91459; MOK9.14; OSJNBa0008D12.4; OSJNBa0072I06.38; OSJNBb0018L1 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | small ribosomal subunit | GO:0015935 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | cytosolic small ribosomal subunit | GO:0022627 | Cellular Component | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | structural constituent of ribosome | GO:0003735 | Molecular Function | 0.0 | - |
Sma3 | translation | GO:0006412 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ribosomal protein S3, C-terminal | IPR001351 | - | 0.0 | - |
Sma3 | Ankyrin repeat | IPR002110 | - | 0.0 | - |
Sma3 | K Homology domain, type 2 | IPR004044 | - | 0.0 | - |
Sma3 | K Homology domain | IPR004087 | - | 0.0 | - |
Sma3 | Ribosomal protein S3, eukaryotic/archaeal | IPR005703 | - | 0.0 | - |
Sma3 | IPR008282 | - | 0.0 | - | |
Sma3 | K homology domain-like, alpha/beta | IPR015946 | - | 0.0 | - |
Sma3 | Ribosomal protein S3, conserved site | IPR018280 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G53870.1 | Ribosomal protein S3 family protein chr3:19951547-19952782 FORWARD LENGTH=249 | 8.0e-36 | 95% |
RefSeq | Arabidopsis thaliana | NP_190955.1 | 40S ribosomal protein S3-2 [Arabidopsis thaliana] | 1.0e-35 | 95% |
RefSeq | Populus trichocarpa | XP_002322150.1 | predicted protein [Populus trichocarpa] | 9.0e-37 | 96% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NTN5
Fln msg: Distance to subject end: 78 aas, your sequence is shorter than subject: 68 - 233
Fln protein:
N
Protein Length:
69
Fln nts:
A
Fln Alignment:
G5KS2UX02GBYTH___VNNRGLCAIAQAESLFRYKLLGGLAVRRACYGVLRFIMESGAKGCEVIVSGKLRAQRAKSMKFKDG
A9NTN5_______________VNNRGLCAIAQAESL-RYKLLGGLAVRRACYGVLRFIMESGAKGCEVIVSGKLRAQRAKSMKFKDG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain