UniGene Name: sp_v3.0_unigene62300
Length: 228 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene62300
C |
Ace file of the UniGene sp_v3.0_unigene62300 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Pentatricopeptide repeat-containing protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7L3A6_ARALL | - | - | 1.0e-20 | 59% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 62% |
Sma3 | Pentatricopeptide repeat-containing protein, putative | - | - | 4.009e-33 | - |
Source | Gene names |
---|---|
Sma3 | At1g11290; At2g03880; At2g13600; At3g02330; At3g23330; At3g24000; At3g26782; At3g53360; At4g02750; At4g18750; At4g30700; At4g33170; At4g37380; At4g39530; At4g39952; At5g09950; At5g13270; B1032F05.19; DYW9; F11A12.2; F14O13.19; F14P3.1; F23K16.160; F28A21. |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | nuclease activity | GO:0004518 | Molecular Function | 0.0 | - |
Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | nucleotide-excision repair | GO:0006289 | Biological Process | 0.0 | - |
Sma3 | phloem or xylem histogenesis | GO:0010087 | Biological Process | 0.0 | - |
Sma3 | leaf vascular tissue pattern formation | GO:0010305 | Biological Process | 0.0 | - |
Sma3 | cotyledon vascular tissue pattern formation | GO:0010588 | Biological Process | 0.0 | - |
Sma3 | mRNA modification | GO:0016556 | Biological Process | 0.0 | - |
Sma3 | leaf development | GO:0048366 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Beta-lactamase, class-A/D | IPR000871 | - | 0.0 | - |
Sma3 | Legume lectin domain | IPR001220 | - | 0.0 | - |
Sma3 | Kinesin, motor domain | IPR001752 | - | 0.0 | - |
Sma3 | UVR domain | IPR001943 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | Immunoglobulin/major histocompatibility complex, conserved site | IPR003006 | - | 0.0 | - |
Sma3 | Hemimethylated DNA-binding domain | IPR011722 | - | 0.0 | - |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | PDZ-binding protein, CRIPT | IPR019367 | - | 0.0 | - |
Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G23330.1 | Tetratricopeptide repeat (TPR)-like superfamily protein chr3:8347200-8349347 FORWARD LENGTH=715 | 9.0e-26 | 58% |
RefSeq | Arabidopsis thaliana | NP_188975.3 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 1.0e-25 | 58% |
RefSeq | Populus trichocarpa | XP_002307076.1 | predicted protein [Populus trichocarpa] | 1.0e-25 | 52% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9P0W0
Fln msg: Distance to subject end: 257 aas, your sequence is shorter than subject: 76 - 370
Fln protein:
L
Protein Length:
77
Fln nts:
C
Fln Alignment:
G5KS2UX02GDCPE___IDMYSKCGSIQKARELFNKMTSPDAVSWNAMIAGYAMHGSGKEALKLFEQMRISGIKPNHVSFVSVLSACSHAG
A9P0W0_______________VDMYGKCGRIEDAQEVFSKLLEPDVASWNAMISGLAQHGCGKEAVLLFEQMLQTGVKPNQITFVVVLSGCSHAG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain