UniGene Name: sp_v3.0_unigene62231
Length: 200 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene62231
A |
Ace file of the UniGene sp_v3.0_unigene62231
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Putative polyprotein n=1 Tax=Oryza sativa Japonica Group RepID=Q60ET2_ORYSJ | - | - | 1.0e-13 | 69% |
| FL-Next | sp=RNA-directed DNA polymerase homolog; berteroana). Mitochondrion. | - | - | 0.0 | 46% |
| Sma3 | Gag-Pol polyprotein | - | - | 1.347e-13 | - |
| Source | Gene names |
|---|---|
| Sma3 | 20.t00045; AT4g04230; AT4g08100; At2g06890; F9M13.15; H0211A12.9; LOC_Os03g35326; LOC_Os10g16560; LOC_Os10g20440; LOC_Os10g20960; LOC_Os11g21960; LOC_Os11g23970; LOC_Os12g15350; LOC_Os12g19810; LOC_Os12g22610; LOC_Os12g26500; MtrDRAFT_AC158464g34v2; OJ112 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
| Sma3 | cysteine-type peptidase activity | GO:0008234 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
| Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domain | IPR000194 | - | 0.0 | - |
| Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
| Sma3 | Chromo domain/shadow | IPR000953 | - | 0.0 | - |
| Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
| Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
| Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
| Sma3 | Peptidase C48, SUMO/Sentrin/Ubl1 | IPR003653 | - | 0.0 | - |
| Sma3 | Putative S-adenosyl-L-methionine-dependent methyltransferase | IPR004159 | - | 0.0 | - |
| Sma3 | Auxin efflux carrier | IPR004776 | - | 0.0 | - |
| Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
| Sma3 | EGF-like region, conserved site | IPR013032 | - | 0.0 | - |
| Sma3 | IPR013084 | - | 0.0 | - | |
| Sma3 | Retroviral aspartyl protease | IPR013242 | - | 0.0 | - |
| Sma3 | Zinc finger, H2C2-type, histone UAS binding | IPR015416 | - | 0.0 | - |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: P31843
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 45 aas, your sequence is shorter than subject: 66 - 142
Fln protein:
C
Protein Length:
67
Fln nts:
A
Fln Alignment:
G5KS2UX02JV6R5___SGYHQIRLREGYELTISIKINDGLYKWLVMPFGLTNAPMTFIRLINEVL
P31843_______________SGYWQVRIAKGDEPKTTCVTRYGSFEFRVMPFGLTNALATFCNLMNNVL

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta