|
||||||
|
UniGene Name: sp_v3.0_unigene62225
Length: 217 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene62225
A |
|
Ace file of the UniGene sp_v3.0_unigene62225
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Copia-type polyprotein, putative n=4 Tax=Arabidopsis thaliana RepID=Q9C739_ARATH | - | - | 1.0e-16 | 59% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 50% |
| Source | Gene names |
|---|---|
| Sma3 | At2g13930; F11I4_21; SDM1_42t00010; T15M6.14; T16L24.270; T18I24.5; T20K12.230; T28P6.8; TnInt1; VITISV_001479; VITISV_001707; VITISV_003274; VITISV_003944; VITISV_005765; VITISV_006839; VITISV_008416; VITISV_010605; VITISV_015274; VITISV_015834; VITISV_0 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | ionotropic glutamate receptor activity | GO:0004970 | Molecular Function | 0.0 | - |
| Sma3 | extracellular-glutamate-gated ion channel activity | GO:0005234 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | potassium ion transmembrane transporter activity | GO:0015079 | Molecular Function | 0.0 | - |
| Sma3 | manganese ion binding | GO:0030145 | Molecular Function | 0.0 | - |
| Sma3 | nutrient reservoir activity | GO:0045735 | Molecular Function | 0.0 | - |
| Sma3 | potassium ion transport | GO:0006813 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
| Sma3 | Ionotropic glutamate receptor | IPR001320 | - | 0.0 | - |
| Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
| Sma3 | Pleckstrin homology domain | IPR001849 | - | 0.0 | - |
| Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
| Sma3 | Germin | IPR001929 | - | 0.0 | - |
| Sma3 | DNA methylase, N-6 adenine-specific, conserved site | IPR002052 | - | 0.0 | - |
| Sma3 | K+ potassium transporter | IPR003855 | - | 0.0 | - |
| Sma3 | Cupin 1 | IPR006045 | - | 0.0 | - |
| Sma3 | IPR013084 | - | 0.0 | - | |
| Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat-containing N-terminal, type 2 | IPR013210 | - | 0.0 | - |
| Sma3 | RmlC-like jelly roll fold | IPR014710 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | Germin, manganese binding site | IPR019780 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LKX7
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 226 aas, your sequence is shorter than subject: 72 - 407
Fln protein:
M
Protein Length:
73
Fln nts:
A
Fln Alignment:
G5KS2UX02IYV5P___CVYGKQNRVSFPSGGK-RTKQILELVHSDVFGPVKVPSLGKSVYYVSFIDDFSRNTWIYFLKKKSEVFDR
B8LKX7_______________CMSGKQHMEKFIKGKSWRAKTPLHLVHSDLMGPLEHPSISGSRYVLTFIDDYSRRIWVYFLKNKDEVFEK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
