UniGene Name: sp_v3.0_unigene62201
Length: 238 nt
UniGene Fasta |
---|
>sp_v3.0_unigene62201
A |
Ace file of the UniGene sp_v3.0_unigene62201 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Protein phosphatase 2c, putative n=1 Tax=Ricinus communis RepID=B9RKK9_RICCO | - | - | 9.0e-19 | 65% |
FL-Next | sp=Protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 70% |
Source | Gene names |
---|---|
Sma3 | At2g20050; CHLREDRAFT_127872; GSVIVT00016693001; OSJNBa0063E14.1-1; OSTLU_4795; Os02g0281000; OsI_06757; OsJ_06259; Ot11g00890; P0669G10.18-1; PHYPADRAFT_185240; PHYPADRAFT_185987; PHYPADRAFT_22803; POPTRDRAFT_910927; RCOM_1050860; T2G17.15; VITISV_000895 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cAMP-dependent protein kinase complex | GO:0005952 | Cellular Component | 0.0 | - |
Sma3 | protein serine/threonine phosphatase complex | GO:0008287 | Cellular Component | 0.0 | - |
Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine phosphatase activity | GO:0004722 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | cAMP-dependent protein kinase regulator activity | GO:0008603 | Molecular Function | 0.0 | - |
Sma3 | manganese ion binding | GO:0030145 | Molecular Function | 0.0 | - |
Sma3 | regulation of protein phosphorylation | GO:0001932 | Biological Process | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | protein dephosphorylation | GO:0006470 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protease inhibitor I4, serpin | IPR000215 | - | 0.0 | - |
Sma3 | Protein phosphatase 2C, manganese/magnesium aspartate binding site | IPR000222 | - | 0.0 | - |
Sma3 | Cyclic nucleotide-binding domain | IPR000595 | - | 0.0 | - |
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Protein phosphatase 2C-like | IPR001932 | - | 0.0 | - |
Sma3 | cAMP/cGMP-dependent protein kinase | IPR002373 | - | 0.0 | - |
Sma3 | IPR014045 | - | 0.0 | - | |
Sma3 | RmlC-like jelly roll fold | IPR014710 | - | 0.0 | - |
Sma3 | Protein phosphatase 2C | IPR015655 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G20050.1 | " protein serine/threonine phosphatases;protein kinases;catalytics;cAMP-dependent protein kinase regulators;ATP binding;protein serine/threonine phosphatases chr2:8649779-8654193 REVERSE LENGTH=1094" | 2.0e-22 | 70% |
RefSeq | Arabidopsis thaliana | NP_001189557.1 | protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein [Arabidopsis thaliana] | 2.0e-22 | 70% |
RefSeq | Populus trichocarpa | XP_002324434.1 | predicted protein [Populus trichocarpa] | 4.0e-20 | 62% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9SL76
Fln msg: Distance to subject end: 752 aas, your sequence is shorter than subject: 79 - 1094
Fln protein:
N
Protein Length:
80
Fln nts:
A
Fln Alignment:
G5KS2UX02F3VH3___WGTEEDDEAGDPPRIWLPDANYPGTAFTRSIGDRTAESIGVIAVPEITVLDLTADQPF
Q9SL76_______________WGTEEDDD-GDPPRLWVPNGMYPGTAFTRSIGDSIAETIGVVANPEIAVVELTPDNPF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain