UniGene Name: sp_v3.0_unigene62181
Length: 214 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene62181
A |
Ace file of the UniGene sp_v3.0_unigene62181
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | putative helicase [Oryza sativa Japonica Group] | - | - | 7.0e-31 | 92% |
| FL-Next | sp=Probable pre-mRNA-splicing factor ATP-dependent RNA helicase; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 48% |
| Sma3 | Putative RNA helicase A | - | - | 2.414e-11 | - |
| Source | Gene names |
|---|---|
| Sma3 | At2g01130; At2g30800; At2g35920; B1143G03.7-1; F11I4_16; GSVIVT00003545001; GSVIVT00009138001; GSVIVT00017756001; GSVIVT00018850001; GSVIVT00030427001; LOC_Os03g53760; MICPUCDRAFT_197; MICPUCDRAFT_45131; MICPUCDRAFT_45812; MICPUN_77912; MICPUN_79480; MICP |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | double-stranded RNA binding | GO:0003725 | Molecular Function | 0.0 | - |
| Sma3 | helicase activity | GO:0004386 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | ATP-dependent helicase activity | GO:0008026 | Molecular Function | 0.0 | - |
| Sma3 | chalcone isomerase activity | GO:0045430 | Molecular Function | 0.0 | - |
| Sma3 | flavonoid biosynthetic process | GO:0009813 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G04895.1 | DEA(D/H)-box RNA helicase family protein chr5:1428796-1434516 FORWARD LENGTH=1161 | 3.0e-36 | 89% |
| RefSeq | Arabidopsis thaliana | NP_680142.2 | DEA(D/H)-box RNA helicase family protein [Arabidopsis thaliana] | 3.0e-36 | 89% |
| RefSeq | Populus trichocarpa | XP_002316463.1 | predicted protein, partial [Populus trichocarpa] | 1.0e-38 | 95% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q38953
Fln msg: Distance to subject end: 332 aas, your sequence is shorter than subject: 71 - 1168
Fln protein:
N
Protein Length:
72
Fln nts:
A
Fln Alignment:
G5KS2UX02IOX2V___QKLIFEKPPPNVRKIVLATNMAEASITINDVVFVVDCGKAKETSYDALNNTPCLLPSWISRASARQ
Q38953_______________QSRIFDPPPPGKRKVVVATNIAEASLTIDGIYYVVDPGFAKQNVYNPKQGLESLVITPISQASAKQ

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta