UniGene Name: sp_v3.0_unigene62107
Length: 232 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene62107
A |
Ace file of the UniGene sp_v3.0_unigene62107 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative 2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase [Oryza sativa Japonica Group] dbj|BAD30586.1| putative 2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase [Oryza sativa Japonica Group] dbj|BAD30801.1| putative 2- | - | - | 3.0e-26 | 70% |
FL-Next | tr=Dihydropterin pyrophosphokinase-dihydropteroate synthase; Solanum lycopersicum (Tomato) (Lycopersicon esculentum). | - | - | 0.0 | 77% |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Dihydropteroate synthase. | EC:2.5.1.15 | - | 7.041e-13 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Folate biosynthesis | 00790 | 7.041e-13 | % | |
Sma3 | Biosynthesis of phenylpropanoids | 01061 | 7.041e-13 | % | |
Sma3 | Metabolic pathways | 01100 | 7.041e-13 | % | |
Sma3 | 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase. | EC:2.7.6.3 | - | 9.505e-09 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Folate biosynthesis | 00790 | 9.505e-09 | % | |
Sma3 | Metabolic pathways | 01100 | 9.505e-09 | % |
Source | Gene names |
---|---|
Sma3 | AT4g30000; At1g69190; At4g30000; At4g30000/F6G3_30; B1056G08.147-1; B1056G08.147-2; F23O10.22; F6G3.30; GSVIVT00030018001; Os07g0618500; OsI_26885; OsJ_25143; P0552F09.130-1; P0552F09.130-2; P0560B08.103-1; P0560B08.103-2; PHYPADRAFT_125522; POPTRDRAFT_41 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
Sma3 | 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase activity | GO:0003848 | Molecular Function | 0.0 | - |
Sma3 | dihydropteroate synthase activity | GO:0004156 | Molecular Function | 0.0 | - |
Sma3 | kinase activity | GO:0016301 | Molecular Function | 0.0 | - |
Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
Sma3 | folic acid-containing compound biosynthetic process | GO:0009396 | Biological Process | 0.0 | - |
Sma3 | tetrahydrofolate biosynthetic process | GO:0046654 | Biological Process | 0.0 | - |
Sma3 | folic acid biosynthetic process | GO:0046656 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Pterin-binding | IPR000489 | - | 0.0 | - |
Sma3 | 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase, HPPK | IPR000550 | - | 0.0 | - |
Sma3 | Dihydropteroate synthase | IPR006390 | - | 0.0 | - |
Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G30000.2 | Dihydropterin pyrophosphokinase / Dihydropteroate synthase chr4:14670417-14672397 REVERSE LENGTH=561 | 1.0e-32 | 68% |
RefSeq | Arabidopsis thaliana | NP_194729.1 | Dihydropterin pyrophosphokinase / Dihydropteroate synthase [Arabidopsis thaliana] | 1.0e-32 | 68% |
RefSeq | Populus trichocarpa | XP_002311349.1 | predicted protein, partial [Populus trichocarpa] | 2.0e-36 | 77% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: tr_plants
Fln subject: C5IXL4
Fln msg: Distance to subject end: 240 aas, your sequence is shorter than subject: 77 - 512
Fln protein:
F
Protein Length:
78
Fln nts:
A
Fln Alignment:
G5KS2UX02IUVQ8___FEAWEKLGGEDLMGREGMKRVLPIGNELLDWSRKTHVMGVLNLTPDSFSDGGRYTSVENAVDQVRLMISEGADMID
C5IXL4_______________FELWEKLGGESLVGRNGMKRVLPVGNHLWDWSLKTSLMGILNLTPDSFSDGGKYISVEAAVSQARLMLSEGADMID
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain