UniGene Name: sp_v3.0_unigene62046
Length: 246 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene62046
A |
Ace file of the UniGene sp_v3.0_unigene62046 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Putative gag-pol polyprotein n=1 Tax=Oryza sativa Japonica Group RepID=Q9FW76_ORYSJ | - | - | 2.0e-18 | 63% |
| FL-Next | sp=RNA-directed DNA polymerase homolog; berteroana). Mitochondrion. | - | - | 0.0 | 66% |
| Sma3 | Retrotransposon protein, putative, unclassified | - | - | 4.938e-09 | - |
| Source | Gene names |
|---|---|
| Sma3 | At2g07660; H0124B04.16; H0321H01.8; H0502G05.6; LOC_Os03g05340; LOC_Os03g07050; LOC_Os03g10000; LOC_Os10g42880; LOC_Os11g32060; LOC_Os11g35200; LOC_Os11g38750; LOC_Os12g04880; LOC_Os12g18080; MtrDRAFT_AC155896g19v2; MtrDRAFT_AC155896g21v2; OJ1187_E11.7; O |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
| Sma3 | triglyceride lipase activity | GO:0004806 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | GO:0008415 | Molecular Function | 0.0 | - | |
| Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
| Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | lipid metabolic process | GO:0006629 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
| Sma3 | Chromo domain/shadow | IPR000953 | - | 0.0 | - |
| Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
| Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
| Sma3 | Protein translocase complex, SecE/Sec61-gamma subunit | IPR001901 | - | 0.0 | - |
| Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
| Sma3 | Phospholipid/glycerol acyltransferase | IPR002123 | - | 0.0 | - |
| Sma3 | Lipase, class 3 | IPR002921 | - | 0.0 | - |
| Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
| Sma3 | Carbamoyl-phosphate synthetase, large subunit, ATP-binding | IPR005479 | - | 0.0 | - |
| Sma3 | Protein of unknown function DUF594 | IPR007658 | - | 0.0 | - |
| Sma3 | Peptidase aspartic, catalytic | IPR009007 | - | 0.0 | - |
| Sma3 | IPR013084 | - | 0.0 | - | |
| Sma3 | Retroviral aspartyl protease | IPR013242 | - | 0.0 | - |
| Sma3 | Zinc finger, H2C2-type, histone UAS binding | IPR015416 | - | 0.0 | - |
| Sma3 | MULE transposase domain | IPR018289 | - | 0.0 | - |
| Sma3 | Peroxidase, active site | IPR019794 | - | 0.0 | - |
Full-Lengther Next Prediction |
|---|
Fln status: Putative N-terminus
Fln database: sp_plants
Fln subject: P31843
Fln msg: Distance to subject end: 106 aas, W2: There is no M at the beginning, your sequence is shorter than subject: 81 - 142
Fln protein:
N
Protein Length:
82
Fln nts:
A
Fln Alignment:
G5KS2UX02GXFV6___TLRLCIDYQALIKNTLKNKYPIPHIDELMD
P31843_______________SLRMCIDYRALTKVTIKNKYPIPRVDDLFD

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)