SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene61996

Length: 223 nt

UniGene Fasta

>sp_v3.0_unigene61996
AATGTCATTTGTACTGAAAACATCACTTGCGGACCAGGTCACGGGATCAGCAGTATTGGAAGCTTGGGTGAGGGAAGCGCAAAGGCCCAGGTCGCTGATGTGATGGTACATGGCGCCTTTCTTGAGAATACAACAAATGGTCTCAGAATCAAGACTTGGCAGGGCAGCTCTGGCTTTGCTAGGAGGATCACATTTCAAAATGTGCAAATGCAGAATGTCAAAC

Ace file of the UniGene sp_v3.0_unigene61996

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Glycoside hydrolase, family 28 [Medicago truncatula]	-	-	2.0e-09	63%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	76%
Sma3	Polygalacturonase	-	-	9.59e-37	-

Source	ECs	Term	Type	e value	Identity
Sma3	Polygalacturonase.	EC:3.2.1.15	-	8.218e-29	-

Source	KEGGs	Term	Type	e value	Identity
Sma3	Pentose and glucuronate interconversions	00040		8.218e-29	%
Sma3	Starch and sucrose metabolism	00500		8.218e-29	%
Sma3	Metabolic pathways	01100		8.218e-29	%
Sma3	Galacturan 1,4-alpha-galacturonidase.	EC:3.2.1.67	-	1.06e-11	-

Source	KEGGs	Term	e value	Identity
Sma3	Pentose and glucuronate interconversions	00040	1.06e-11	%
Sma3	Starch and sucrose metabolism	00500	1.06e-11	%
Sma3	Metabolic pathways	01100	1.06e-11	%

Source	Gene names
Sma3	ADPG1; ADPG2; At1g70500; At2g41850; At3g07970; At3g57510; Cry j 2.1; Cry j 2.2; Cry j 2.3; Cryj2; F17A17.31; F24J13.7; F5O8.2; GSVIVT00002738001; GSVIVT00025514001; GSVIVT00025516001; GSVIVT00025518001; GSVIVT00025519001; GSVIVT00025571001; GSVIVT00028778

Source	GOs	Term	Type	Identity
Sma3	extracellular region	GO:0005576	Cellular Component	-
Sma3	cell wall	GO:0005618	Cellular Component	-
Sma3	amyloplast	GO:0009501	Cellular Component	-
Sma3	apoplast	GO:0048046	Cellular Component	-
Sma3	polygalacturonase activity	GO:0004650	Molecular Function	-
Sma3	protein serine/threonine kinase activity	GO:0004674	Molecular Function	-
Sma3	binding	GO:0005488	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	carbohydrate metabolic process	GO:0005975	Biological Process	-
Sma3	protein phosphorylation	GO:0006468	Biological Process	-
Sma3	cellular cell wall organization	GO:0007047	Biological Process	-
Sma3	cell wall modification involved in abscission	GO:0009830	Biological Process	-
Sma3	fruit ripening	GO:0009835	Biological Process	-
Sma3	anther dehiscence	GO:0009901	Biological Process	-
Sma3	fruit dehiscence	GO:0010047	Biological Process	-
Sma3	floral organ abscission	GO:0010227	Biological Process	-
Sma3	pectin catabolic process	GO:0045490	Biological Process	-
Sma3	pollen sperm cell differentiation	GO:0048235	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Regulator of chromosome condensation, RCC1	IPR000408	-	-
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	Glycoside hydrolase, family 28	IPR000743	-	-
Sma3	Pentatricopeptide repeat	IPR002885	-	-
Sma3	Parallel beta-helix repeat	IPR006626	-	-
Sma3	Serine/threonine-protein kinase, active site	IPR008271	-	-
Sma3	Tetratricopeptide-like helical	IPR011990	-	-
Sma3	Pectin lyase fold	IPR012334	-	-
Sma3		IPR017442	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT1G70500.1	Pectin lyase-like superfamily protein chr1:26566579-26568729 REVERSE LENGTH=468	1.0e-11	55%
RefSeq	Arabidopsis thaliana	NP_177207.1	pectin lyase-like protein [Arabidopsis thaliana]	2.0e-11	55%
RefSeq	Populus trichocarpa	XP_002299601.1	predicted protein [Populus trichocarpa]	4.0e-13	69%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LQX9

Fln msg: Distance to subject end: 127 aas, your sequence is shorter than subject: 74 - 493

Fln protein: NVICTENITCGPGHGISSIGSLGEGSAKAQVADVMVHGAFLENTTNGLRIKTWQGSSGFARRITFQNVQMQNVK

Protein Length: 75

Fln nts: AATGTCATTTGTACTGAAAACATCACTTGCGGACCAGGTCACGGGATCAGCAGTATTGGAAGCTTGGGTGAGGGAAGCGCAAAGGCCCAGGTCGCTGATGTGATGGTACATGGCGCCTTTCTTGAGAATACAACAAATGGTCTCAGAATCAAGACTTGGCAGGGCAGCTCTGGCTTTGCTAGGAGGATCACATTTCAAAATGTGCAAATGCAGAATGTCAAAC

Fln Alignment:

G5KS2UX02GSBI3___ICTENITCXXXXXXXXXXXXXXXXAKAQVADVMVHGAFLENTTNGLRIKTWQGSSGFARRITFQNVQMQNVK
B8LQX9_______________IYIENITCGPGHGISIGSLGEGS-AKARVADVMVHGAFLHNTTNGLRIKTWQGSSGSARRILFQNVHMENVK

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain