|
||||||
|
UniGene Name: sp_v3.0_unigene61953
Length: 209 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene61953
A |
|
Ace file of the UniGene sp_v3.0_unigene61953
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | MRP-like ABC transporter [Oryza sativa Japonica Group] | - | - | 1.0e-09 | 58% |
| FL-Next | sp=ABC transporter C family member 5; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 62% |
| Sma3 | Multidrug resistance protein ABC transporter family | - | - | 2.258e-10 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g04120; F20D22.11; GSVIVT00028494001; MRP5; POPTRDRAFT_420503; POPTRDRAFT_769001; POPTRDRAFT_816970; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plant-type vacuole | GO:0000325 | Cellular Component | 0.0 | - |
| Sma3 | vacuolar membrane | GO:0005774 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | sulfonylurea receptor activity | GO:0008281 | Molecular Function | 0.0 | - |
| Sma3 | xenobiotic-transporting ATPase activity | GO:0008559 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity, coupled to transmembrane movement of substances | GO:0042626 | Molecular Function | 0.0 | - |
| Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | cellular potassium ion homeostasis | GO:0030007 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | ABC transporter, transmembrane domain | IPR001140 | - | 0.0 | - |
| Sma3 | ABC transporter-like | IPR003439 | - | 0.0 | - |
| Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
| Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
| Sma3 | ABC transporter, integral membrane type 1 | IPR017940 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G04120.1 | ATMRP5, MRP5, ATABCC5, ABCC5 multidrug resistance-associated protein 5 chr1:1064848-1070396 REVERSE LENGTH=1514 | 2.0e-11 | 62% |
| RefSeq | Arabidopsis thaliana | NP_001184906.1 | ABC transporter C family member 5 [Arabidopsis thaliana] | 3.0e-11 | 62% |
| RefSeq | Populus trichocarpa | XP_002321253.1 | multidrug resistance protein ABC transporter family [Populus trichocarpa] | 1.0e-11 | 58% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q7GB25
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 908 aas, your sequence is shorter than subject: 69 - 1514
Fln protein:
M
Protein Length:
70
Fln nts:
A
Fln Alignment:
G5KS2UX02HJ9EU___LTAGNIFSALATFGSLQGAIGFLPTLISMFAQAKVSIDRIVAFLREEELQ
Q7GB25_______________LTAGGVLSALATFRILQEPLRNFPDLVSMMAQTKVSLDRISGFLQEEELQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
