UniGene Name: sp_v3.0_unigene61946
Length: 100 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene61946
A |
Ace file of the UniGene sp_v3.0_unigene61946
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Ubiquitin carrier protein n=1 Tax=Ricinus communis RepID=B9SRR5_RICCO | - | - | 8.0e-09 | 93% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 93% |
| Sma3 | Ubiquitin carrier protein | - | - | 3.958e-24 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ligases, Forming carbon-nitrogen bonds, Acid--D-amino-acid ligases (peptide synthases). | EC:6.3.2.- | - | 1.407e-22 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Tryptophan metabolism | 00380 | 1.407e-22 | % | |
| Sma3 | Biosynthesis of siderophore group nonribosomal peptides | 01053 | 1.407e-22 | % | |
| Sma3 | Ubiquitin--protein ligase. | EC:6.3.2.19 | - | 2.191e-12 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT5G41700; AT5G53300; At1g64230; At2g16740; At3g08690; At3g08700; At4g27960; At5g41700; At5g53300; B0811B10.8; B1043F11.37; CHLREDRAFT_152525; Elr; F17O14.16; F17O14.17; F22C12.2; GSVIVT00002469001; GSVIVT00006484001; GSVIVT00023383001; GSVIVT00023926001; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | ubiquitin-protein ligase activity | GO:0004842 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | small conjugating protein ligase activity | GO:0019787 | Molecular Function | 0.0 | - |
| Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
| Sma3 | modification-dependent protein catabolic process | GO:0019941 | Biological Process | 0.0 | - |
| Sma3 | post-translational protein modification | GO:0043687 | Biological Process | 0.0 | - |
| Sma3 | cell redox homeostasis | GO:0045454 | Biological Process | 0.0 | - |
| Sma3 | regulation of protein metabolic process | GO:0051246 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ubiquitin-conjugating enzyme, E2 | IPR000608 | - | 0.0 | - |
| Sma3 | Thioredoxin domain | IPR013766 | - | 0.0 | - |
| Sma3 | Ubiquitin-conjugating enzyme/RWD-like | IPR016135 | - | 0.0 | - |
| Sma3 | IPR017936 | - | 0.0 | - | |
| Sma3 | Thioredoxin, conserved site | IPR017937 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G27960.2 | UBC9 ubiquitin conjugating enzyme 9 chr4:13916065-13917293 REVERSE LENGTH=178 | 5.0e-14 | 90% |
| RefSeq | Arabidopsis thaliana | NP_001154776.1 | ubiquitin-conjugating enzyme E2 10 [Arabidopsis thaliana] | 5.0e-14 | 90% |
| RefSeq | Populus trichocarpa | XP_002325633.1 | predicted protein [Populus trichocarpa] | 2.0e-14 | 93% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NKT3
Fln msg: Distance to subject end: 100 aas, your sequence is shorter than subject: 33 - 148
Fln protein:
M
Protein Length:
34
Fln nts:
A
Fln Alignment:
G5KS2UX02HLTHI___TSCSAGPVFAEDMFHWQATIMGPGDSPYAGG
A9NKT3_______________TSCSAGPV-AEDMFHWQATIMGPSDSPYAGG

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta