|
||||||
|
UniGene Name: sp_v3.0_unigene61932
Length: 207 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene61932
A |
|
Ace file of the UniGene sp_v3.0_unigene61932 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Retrotransposon protein, putative, unclassified n=2 Tax=Oryza sativa Japonica Group RepID=Q53P05_ORYSJ | - | - | 1.0e-18 | 67% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 50% |
| Sma3 | Retrotransposon protein, putative, Ty3-gypsy subclass | - | - | 8.429e-32 | - |
| Source | Gene names |
|---|---|
| Sma3 | At2g04670; At2g07660; At2g10780; B1160F02.12; F9D12.11; H0124B04.16; H0201G08.12; H0306B06.3; H0321H01.8; H0616A11.2; H0807C06-H0308C08.3; LOC_Os03g05340; LOC_Os03g06110; LOC_Os03g07050; LOC_Os03g10000; LOC_Os03g13350; LOC_Os03g15450; LOC_Os03g26020; LOC_ |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | GO:0008415 | Molecular Function | 0.0 | - | |
| Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
| Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
| Sma3 | Chromo domain/shadow | IPR000953 | - | 0.0 | - |
| Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
| Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
| Sma3 | Protein translocase complex, SecE/Sec61-gamma subunit | IPR001901 | - | 0.0 | - |
| Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
| Sma3 | Phospholipid/glycerol acyltransferase | IPR002123 | - | 0.0 | - |
| Sma3 | Exostosin-like | IPR004263 | - | 0.0 | - |
| Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
| Sma3 | Carbamoyl-phosphate synthetase, large subunit, ATP-binding | IPR005479 | - | 0.0 | - |
| Sma3 | Protein of unknown function DUF594 | IPR007658 | - | 0.0 | - |
| Sma3 | Peptidase aspartic, catalytic | IPR009007 | - | 0.0 | - |
| Sma3 | IPR013084 | - | 0.0 | - | |
| Sma3 | Retroviral aspartyl protease | IPR013242 | - | 0.0 | - |
| Sma3 | Zinc finger, H2C2-type, histone UAS binding | IPR015416 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Complete
Fln database: coniferopsida.fasta
Fln subject: A9NWN2
Fln msg: your sequence is shorter than subject: 46 - 66
Fln protein:
M
Protein Length:
47
Fln nts:
A
Fln Alignment:
G5KS2UX02JVMB3___YAAPMVLVRKKDRSCRLCIDYRGLNKITIKNKFAVLFIDEMLDELLGAK*FSKLDLRSGY
A9NWN2_______________YSTPIILVRINDGSYILCNNCRVLNEITIKDKFHISIVDELLDELYGTMYFLELDQKSNY
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
