UniGene Name: sp_v3.0_unigene61882
Length: 226 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene61882
G |
Ace file of the UniGene sp_v3.0_unigene61882 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | MAP kinase kinase (Fragment) n=2 Tax=Origanum onites RepID=A7UJ13_9LAMI | - | - | 3.0e-27 | 80% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 100% |
Sma3 | MAP kinase kinase | - | - | 7.837e-28 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Mitogen-activated protein kinase kinase. | EC:2.7.12.2 | - | 4.847e-14 | - |
Source | Gene names |
---|---|
Sma3 | ANQ1; AT4G29810; At4g29810; At5g56580; F27B13.50; GSVIVT00016514001; GSVIVT00016645001; LOC_Os01g32660; LeMKK1; LeMKK3; MAP2K; MAPKK; MAPKK1; MEK1; MIK19.2; MK1; MKK1; MKK2; MKK6; NbMEK1; Os01g0510100; Os06g0147800; OsI_02144; OsJ_20122; P0036F10.40; P045 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | MAP kinase kinase activity | GO:0004708 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | MAPK cascade | GO:0000165 | Biological Process | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | cold acclimation | GO:0009631 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | defense response, incompatible interaction | GO:0009814 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G56580.1 | ATMKK6, ANQ1, MKK6 MAP kinase kinase 6 chr5:22904851-22906620 REVERSE LENGTH=356 | 3.0e-27 | 83% |
RefSeq | Arabidopsis thaliana | NP_200469.1 | mitogen-activated protein kinase kinase 6 [Arabidopsis thaliana] | 4.0e-27 | 83% |
RefSeq | Populus trichocarpa | XP_002330495.1 | predicted protein [Populus trichocarpa] | 2.0e-27 | 81% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5A9P4
Fln msg: Warning!, your query overlaps and the subject is separated, Distance to subject end: 146 aas, your sequence is shorter than subject: 75 - 349
Fln protein:
I
Protein Length:
76
Fln nts:
G
Fln Alignment:
G5KS2UX02IVUBP___IQESVRKQIVQELKINQASQCPNVVVCYHAFYNNGVIxxxxxxxxxxxxxxxxxxxxxxxxxYLAVICKQVLKGLIYLHRDRHIIHRDIKPSNLLVNHK
D5A9P4_______________IQESVRKQIVQELKINQASQCPNVVVCYHAFYNNGVIxxxxxxxxxxxxxxxxxxxxxxxxxYLAVICKQVLKGLIYLHRDRHIIHRDIKPSNLLVNHK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain