|
||||||
|
UniGene Name: sp_v3.0_unigene61837
Length: 154 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene61837
T |
|
Ace file of the UniGene sp_v3.0_unigene61837
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Asparagine synthetase n=3 Tax=Pinaceae RepID=E7EAQ2_PINPS | - | - | 2.0e-21 | 94% |
| FL-Next | sp=Asparagine synthetase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 96% |
| Sma3 | Asparagine synthetase | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Asparagine synthase (glutamine-hydrolyzing). | EC:6.3.5.4 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Alanine, aspartate and glutamate metabolism | 00250 | 0.0 | % | |
| Sma3 | Nitrogen metabolism | 00910 | 0.0 | % | |
| Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | 117M18_15; AND1; AS; AS1; AS2; AS3; ASN1; ASN2; ASN3; As1; As2; AsAS1; AsAS2; Asn1; AsnS1; AsnS2; AsnS3; AsnS4; At3g47340; At5g10240; At5g65010; CHLREDRAFT_140252; F18D22_10; GSVIVT00005225001; GSVIVT00012863001; GSVIVT00024074001; HAS1; HAS1.1; HAS2; LOC |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | asparagine synthase (glutamine-hydrolyzing) activity | GO:0004066 | Molecular Function | 0.0 | - |
| Sma3 | asparagine biosynthetic process | GO:0006529 | Biological Process | 0.0 | - |
| Sma3 | glutamine metabolic process | GO:0006541 | Biological Process | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Sma3 | cellular amino acid catabolic process | GO:0009063 | Biological Process | 0.0 | - |
| Sma3 | response to absence of light | GO:0009646 | Biological Process | 0.0 | - |
| Sma3 | response to sucrose stimulus | GO:0009744 | Biological Process | 0.0 | - |
| Sma3 | response to glucose stimulus | GO:0009749 | Biological Process | 0.0 | - |
| Sma3 | response to fructose stimulus | GO:0009750 | Biological Process | 0.0 | - |
| Sma3 | cellular response to sucrose starvation | GO:0043617 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glutamine amidotransferase, class-II | IPR000583 | - | 0.0 | - |
| Sma3 | Asparagine synthase | IPR001962 | - | 0.0 | - |
| Sma3 | Asparagine synthase, glutamine-hydrolyzing | IPR006426 | - | 0.0 | - |
| Sma3 | Rossmann-like alpha/beta/alpha sandwich fold | IPR014729 | - | 0.0 | - |
| Sma3 | Glutamine amidotransferase, type II | IPR017932 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G10240.1 | ASN3 asparagine synthetase 3 chr5:3212934-3216418 REVERSE LENGTH=578 | 2.0e-25 | 91% |
| RefSeq | Arabidopsis thaliana | NP_001031864.1 | asparagine synthetase 3 [Arabidopsis thaliana] | 3.0e-25 | 91% |
| RefSeq | Populus trichocarpa | XP_002306310.1 | predicted protein, partial [Populus trichocarpa] | 6.0e-26 | 93% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LMV0
Fln msg: Distance to subject end: 418 aas, your sequence is shorter than subject: 51 - 591
Fln protein:
F
Protein Length:
52
Fln nts:
T
Fln Alignment:
G5KS2UX02HYHOY___FVLLDTRDQSFIAARDAFGITPLYIGWGLDGSVWFASEMKALHDDCERFET
B8LMV0_______________FVLLDTRDQSFIAARDAFGITSLYIGWGLDGSVWFASEMKALHDDCERFES
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
