|
||||||
|
UniGene Name: sp_v3.0_unigene61826
Length: 208 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene61826
G |
|
Ace file of the UniGene sp_v3.0_unigene61826 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Phytochrome N (Fragment) n=12 Tax=Pinaceae RepID=Q9FSD5_PINSY | - | - | 9.0e-31 | 100% |
| FL-Next | sp=Phytochrome; Picea abies (Norway spruce) (Picea excelsa). | - | - | 0.0 | 68% |
| Sma3 | Phytochrome A | - | - | 8.40779e-44 | - |
| Source | Gene names |
|---|---|
| Sma3 | ArPHYA16; ArPHYA23; At1g09570; F14J9.23; FHY2; FRE1; GSVIVT00022486001; GSVIVT00029101001; GmphyA1; GmphyA2; HY8; OsI_013116; PHY; PHYA; PHYA1; PHYA4; PHYC; POPTRDRAFT_729311; PhyMpd; VITISV_020287; phyA; phyA2; phyN; phya; phyn; phyo; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | nuclear speck | GO:0016607 | Cellular Component | 0.0 | - |
| Sma3 | two-component sensor activity | GO:0000155 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | G-protein coupled photoreceptor activity | GO:0008020 | Molecular Function | 0.0 | - |
| Sma3 | red or far-red light photoreceptor activity | GO:0009883 | Molecular Function | 0.0 | - |
| Sma3 | protein homodimerization activity | GO:0042803 | Molecular Function | 0.0 | - |
| Sma3 | two-component signal transduction system (phosphorelay) | GO:0000160 | Biological Process | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | signal transduction | GO:0007165 | Biological Process | 0.0 | - |
| Sma3 | sensory perception | GO:0007600 | Biological Process | 0.0 | - |
| Sma3 | red, far-red light phototransduction | GO:0009585 | Biological Process | 0.0 | - |
| Sma3 | gravitropism | GO:0009630 | Biological Process | 0.0 | - |
| Sma3 | phototropism | GO:0009638 | Biological Process | 0.0 | - |
| Sma3 | red light signaling pathway | GO:0010161 | Biological Process | 0.0 | - |
| Sma3 | response to continuous far red light stimulus by the high-irradiance response system | GO:0010201 | Biological Process | 0.0 | - |
| Sma3 | response to very low fluence red light stimulus | GO:0010203 | Biological Process | 0.0 | - |
| Sma3 | protein-tetrapyrrole linkage | GO:0017006 | Biological Process | 0.0 | - |
| Sma3 | peptidyl-histidine phosphorylation | GO:0018106 | Biological Process | 0.0 | - |
| Sma3 | protein-chromophore linkage | GO:0018298 | Biological Process | 0.0 | - |
| Sma3 | response to arsenic-containing substance | GO:0046685 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | PAS | IPR000014 | - | 0.0 | - |
| Sma3 | PAS-associated, C-terminal | IPR000700 | - | 0.0 | - |
| Sma3 | Phytochrome | IPR001294 | - | 0.0 | - |
| Sma3 | PAC motif | IPR001610 | - | 0.0 | - |
| Sma3 | GAF domain | IPR003018 | - | 0.0 | - |
| Sma3 | ATPase-like, ATP-binding domain | IPR003594 | - | 0.0 | - |
| Sma3 | Signal transduction histidine kinase, subgroup 1, dimerisation/phosphoacceptor domain | IPR003661 | - | 0.0 | - |
| Sma3 | Signal transduction histidine kinase, core | IPR005467 | - | 0.0 | - |
| Sma3 | Phytochrome A/B/C/D/E | IPR012129 | - | 0.0 | - |
| Sma3 | Phytochrome, central region | IPR013515 | - | 0.0 | - |
| Sma3 | Phytochrome chromophore binding site | IPR013516 | - | 0.0 | - |
| Sma3 | PAS fold-2 | IPR013654 | - | 0.0 | - |
| Sma3 | PAS fold | IPR013767 | - | 0.0 | - |
| Sma3 | Phytochrome chromophore attachment domain | IPR016132 | - | 0.0 | - |
| Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G09570.1 | PHYA, FHY2, FRE1, HY8 phytochrome A chr1:3095498-3099216 REVERSE LENGTH=1122 | 4.0e-20 | 59% |
| RefSeq | Arabidopsis thaliana | NP_001117256.1 | phytochrome A [Arabidopsis thaliana] | 5.0e-20 | 59% |
| RefSeq | Populus trichocarpa | XP_002318913.1 | phytochrome [Populus trichocarpa] | 9.0e-21 | 58% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q40762
Fln msg: Distance to subject end: 401 aas, your sequence is shorter than subject: 69 - 1136
Fln protein:
S
Protein Length:
70
Fln nts:
G
Fln Alignment:
G5KS2UX02HOXT6___EEVLGEPLINLVEETSAENVKRMLHLALQGVEEQNVQIELKRHGSEEDKGPVVLLVNACSSRDLKEN
Q40762_______________DEVIGRPLIDLVQHDSVEIVKKMLYLALQGEEEQNVEIKLKTFGIQEEKGPVVLIVNACSSRDLEEN
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
