|
||||||
|
UniGene Name: sp_v3.0_unigene61790
Length: 235 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene61790
A |
|
Ace file of the UniGene sp_v3.0_unigene61790
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Pentatricopeptide repeat protein (Fragment) n=1 Tax=Cycas revoluta RepID=B3U1U9_CYCRE | - | - | 2.0e-29 | 81% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 77% |
| Sma3 | Pentatricopeptide repeat protein | - | - | 0.0 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g08070; At1g47580; At1g56690; At2g22070; At3g23330; At3g57430; At4g14050; At4g30700; At4g33170; At5g16860; DYW9; F16N3.14; F25P12.87; F2K13_10; F4I10.100; FCAALL.80; GSVIVT00001706001; GSVIVT00002188001; GSVIVT00003383001; GSVIVT00005426001; GSVIVT0000 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
| Sma3 | DNA methylation | GO:0006306 | Biological Process | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Adenosine/AMP deaminase domain | IPR001365 | - | 0.0 | - |
| Sma3 | C-5 cytosine methyltransferase | IPR001525 | - | 0.0 | - |
| Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
| Sma3 | Immunoglobulin/major histocompatibility complex, conserved site | IPR003006 | - | 0.0 | - |
| Sma3 | MAP kinase, conserved site | IPR003527 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - | |
| Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
| Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G47580.1 | Pentatricopeptide repeat (PPR) superfamily protein chr1:17485668-17486387 FORWARD LENGTH=239 | 1.0e-29 | 62% |
| RefSeq | Arabidopsis thaliana | NP_175189.2 | putative lipoyltransferase [Arabidopsis thaliana] | 1.0e-29 | 62% |
| RefSeq | Populus trichocarpa | XP_002302824.1 | predicted protein [Populus trichocarpa] | 7.0e-32 | 72% |
| Full-Lengther Next Prediction |
|---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: D5AAE0
Fln msg: STOP codon was not found. Distance to subject end: 15 aas, your sequence is shorter than subject: 77 - 246
Fln protein:
C
Protein Length:
78
Fln nts:
A
Fln Alignment:
G5KS2UX02IXN39___YAPDTNFVLHDVEEEQKDDIIHHHSEKLAIVFGLINTSPGTPIRIVKNLRVCGDCHHATKFISKIVSREIIVRDAS
D5AAE0_______________YVPDTNFVLHDVEMEQKEHSLYHHSEKLAIAFGLISTLPGLPVRIIKNLRVCGDCHTATKFISKIVEREIIIRDAN
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
