UniGene Name: sp_v3.0_unigene61768
Length: 240 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene61768
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | RecName: Full=Pleiotropic drug resistance protein 1; AltName: Full=NpPDR1 emb|CAC40990.1| ABC1 protein [Nicotiana plumbaginifolia] | - | - | 4.0e-25 | 69% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 65% |
Sma3 | ATP-binding cassette transporter, putative | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phosphonate-transporting ATPase. | EC:3.6.3.28 | - | 1.889e-39 | - |
Sma3 | Heme-transporting ATPase. | EC:3.6.3.41 | - | 2.852e-08 | - |
Source | Gene names |
---|---|
Sma3 | ABC1; At1g15210; At1g15520; At1g59870; At1g66950; At2g26910; At2g29940; At2g36380; At3g16340; At3g30842; B1045F02.15; F12C20.5; F1O11.1; F1O19.3; F23F1.14; F23H11.19; F9L1.15; GSVIVT00012733001; GSVIVT00016813001; GSVIVT00016819001; GSVIVT00021655001; GSV |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | cadmium ion transmembrane transporter activity | GO:0015086 | Molecular Function | 0.0 | - |
Sma3 | ATPase activity | GO:0016887 | Molecular Function | 0.0 | - |
Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
Sma3 | response to biotic stimulus | GO:0009607 | Biological Process | 0.0 | - |
Sma3 | systemic acquired resistance | GO:0009627 | Biological Process | 0.0 | - |
Sma3 | response to ethylene stimulus | GO:0009723 | Biological Process | 0.0 | - |
Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
Sma3 | defense response to fungus, incompatible interaction | GO:0009817 | Biological Process | 0.0 | - |
Sma3 | response to ozone | GO:0010193 | Biological Process | 0.0 | - |
Sma3 | cadmium ion transport | GO:0015691 | Biological Process | 0.0 | - |
Sma3 | lead ion transport | GO:0015692 | Biological Process | 0.0 | - |
Sma3 | negative regulation of defense response | GO:0031348 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ribosomal protein L11 | IPR000911 | - | 0.0 | - |
Sma3 | Legume lectin domain | IPR001220 | - | 0.0 | - |
Sma3 | ABC transporter-like | IPR003439 | - | 0.0 | - |
Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
Sma3 | Pleiotropic drug resistance protein PDR | IPR005285 | - | 0.0 | - |
Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
Sma3 | ABC-2 type transporter | IPR013525 | - | 0.0 | - |
Sma3 | Plant PDR ABC transporter associated | IPR013581 | - | 0.0 | - |
Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
Sma3 | Peptidase S26A, signal peptidase I, serine active site | IPR019756 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G59870.1 | PEN3, PDR8, ATPDR8, ABCG36, ATABCG36 ABC-2 and Plant PDR ABC-type transporter family protein chr1:22034661-22039844 FORWARD LENGTH=1469 | 1.0e-27 | 63% |
RefSeq | Arabidopsis thaliana | NP_176196.1 | ABC transporter G family member 36 [Arabidopsis thaliana] | 2.0e-27 | 63% |
RefSeq | Populus trichocarpa | XP_002298123.1 | pleiotropic drug resistance, ABC transporter family protein, partial [Populus trichocarpa] | 6.0e-32 | 72% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LN70
Fln msg: Distance to subject end: 248 aas, your sequence is shorter than subject: 79 - 443
Fln protein:
P
Protein Length:
80
Fln nts:
G
Fln Alignment:
G5KS2UX02H4RLZ___PEIEVRYEHLNIDANAYVGSRALPTLINYTANMIEGVLGALHLYNSKKATMTILHDVSGIIKPGRMTLLLGPPASGKTT
B8LN70_______________PEIEIRFQDLNISADVYVGSRALPTLINWTVNIVEDALETLRLRKTQKKNLTILHDISGIVKSGRLTLLLGPPASGKTT
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain