|
||||||
|
UniGene Name: sp_v3.0_unigene61717
Length: 238 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene61717
A |
|
Ace file of the UniGene sp_v3.0_unigene61717 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] sp|Q5G1T1.1|PP272_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g49170, chloroplastic; AltName: Full=Protein EMBRYO DEFECTIVE 2261; Flags: Precursor gb|AAW62962.1| emb | - | - | 5.0e-20 | 61% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 64% |
| Sma3 | Pentatricopeptide repeat-containing protein, putative | - | - | 1.071e-09 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g20230; At1g68930; At1g71490; At2g01510; At2g13600; At2g21090; At2g22070; At3g22690; At3g49170; At4g02750; At4g13650; At4g16835; At5g06540; At5g08510; At5g15300; At5g40410; At5g48910; At5g59200; DYW10; EMB2261; F15M7.7; F18A5.40; F26A9.13; F26H11.15; F |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | RNA modification | GO:0009451 | Biological Process | 0.0 | - |
| Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
| Sma3 | thylakoid membrane organization | GO:0010027 | Biological Process | 0.0 | - |
| Sma3 | photosystem II assembly | GO:0010207 | Biological Process | 0.0 | - |
| Sma3 | regulation of chlorophyll biosynthetic process | GO:0010380 | Biological Process | 0.0 | - |
| Sma3 | methylation | GO:0032259 | Biological Process | 0.0 | - |
| Sma3 | cell redox homeostasis | GO:0045454 | Biological Process | 0.0 | - |
| Sma3 | photosystem I assembly | GO:0048564 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Armadillo | IPR000225 | - | 0.0 | - |
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Beta-lactamase, class-A/D | IPR000871 | - | 0.0 | - |
| Sma3 | Heat shock protein DnaJ, N-terminal | IPR001623 | - | 0.0 | - |
| Sma3 | DNA methylase, N-6 adenine-specific, conserved site | IPR002052 | - | 0.0 | - |
| Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
| Sma3 | Putative methylase | IPR004557 | - | 0.0 | - |
| Sma3 | Uncharacterised protein family UPF0497, trans-membrane plant | IPR006702 | - | 0.0 | - |
| Sma3 | Domain of unknown function DUF659 | IPR007021 | - | 0.0 | - |
| Sma3 | Methyltransferase small | IPR007848 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | IPR011523 | - | 0.0 | - | |
| Sma3 | Armadillo-like helical | IPR011989 | - | 0.0 | - |
| Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
| Sma3 | IPR012335 | - | 0.0 | - | |
| Sma3 | Thioredoxin domain | IPR013766 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - | |
| Sma3 | IPR017936 | - | 0.0 | - | |
| Sma3 | Thioredoxin, conserved site | IPR017937 | - | 0.0 | - |
| Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G49170.1 | EMB2261 Tetratricopeptide repeat (TPR)-like superfamily protein chr3:18226954-18229600 REVERSE LENGTH=850 | 2.0e-25 | 61% |
| RefSeq | Arabidopsis thaliana | NP_190486.2 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 3.0e-25 | 61% |
| RefSeq | Populus trichocarpa | XP_002321443.1 | predicted protein [Populus trichocarpa] | 5.0e-29 | 61% |
| Full-Lengther Next Prediction |
|---|
Fln status: N-terminus
Fln database: coniferopsida.fasta
Fln subject: D5AAE0
Fln msg: Distance to subject end: 157 aas, atg_distance in limit (1-15): atg_distance = 11, your sequence is shorter than subject: 79 - 246
Fln protein:
M
Protein Length:
80
Fln nts:
A
Fln Alignment:
G5KS2UX02I99BU___HYACMVDLLGRAGLLKEAVNFIKAMPYKPDTVVLRTLLGACRIYGNTEIGKHAAECLLENNPEDTATYVLLSNIY
D5AAE0_______________HYACMIDLLGRAGRLDEARDFMKTIPFAPDANVWGALLGACRMYGNIDLGKHAAECLFQLEPHNAAKYVLLSNIY
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
