|
||||||
|
UniGene Name: sp_v3.0_unigene61692
Length: 243 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene61692
A |
|
Ace file of the UniGene sp_v3.0_unigene61692
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | RNA helicase - like protein [Arabidopsis thaliana] emb|CAB78848.1| RNA helicase-like protein [Arabidopsis thaliana] | - | - | 5.0e-30 | 82% |
| FL-Next | sp=Probable pre-mRNA-splicing factor ATP-dependent RNA helicase; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 56% |
| Sma3 | ATP-dependent RNA helicase, putative | - | - | 1.335e-21 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT4g16680; AT4g18460; At1g27900; At1g27900/F13K9.28; At1g32490; At2g35340; At2g47250; At3g26560; At3g62310; CHLREDRAFT_121004; CHLREDRAFT_127996; CHLREDRAFT_185922; F13K9.28; F28J12.120; F5D14.27; GSVIVT00002999001; GSVIVT00016254001; GSVIVT00028144001; G |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | helicase activity | GO:0004386 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | ATP-dependent helicase activity | GO:0008026 | Molecular Function | 0.0 | - |
| Sma3 | mRNA processing | GO:0006397 | Biological Process | 0.0 | - |
| Sma3 | RNA splicing | GO:0008380 | Biological Process | 0.0 | - |
| Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
| Sma3 | posttranscriptional gene silencing by RNA | GO:0035194 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Helicase, C-terminal | IPR001650 | - | 0.0 | - |
| Sma3 | DNA/RNA helicase, ATP-dependent, DEAH-box type, conserved site | IPR002464 | - | 0.0 | - |
| Sma3 | Ribosomal protein S1, RNA-binding domain | IPR003029 | - | 0.0 | - |
| Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
| Sma3 | Helicase-associated domain | IPR007502 | - | 0.0 | - |
| Sma3 | TonB box, conserved site | IPR010916 | - | 0.0 | - |
| Sma3 | Domain of unknown function DUF1605 | IPR011709 | - | 0.0 | - |
| Sma3 | Nucleic acid-binding, OB-fold | IPR012340 | - | 0.0 | - |
| Sma3 | Helicase, superfamily 1/2, ATP-binding domain | IPR014001 | - | 0.0 | - |
| Sma3 | IPR014021 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G18465.1 | RNA helicase family protein chr4:10197056-10201611 FORWARD LENGTH=695 | 3.0e-37 | 82% |
| RefSeq | Arabidopsis thaliana | NP_567558.2 | ATP-dependent RNA helicase DDX35 [Arabidopsis thaliana] | 4.0e-37 | 82% |
| RefSeq | Populus trichocarpa | XP_002305762.1 | predicted protein [Populus trichocarpa] | 9.99995e-41 | 86% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q38953
Fln msg: Distance to subject end: 558 aas, your sequence is shorter than subject: 80 - 1168
Fln protein:
C
Protein Length:
81
Fln nts:
A
Fln Alignment:
G5KS2UX02GERU8___IIVGETGSGKSTQIPHYLKEAGWAEGGRLIACTQPRRLAVQTVASRVAEEMDVKVGAEVGYSIRFEDVTTPGVTMVKF
Q38953_______________VVIGETGSGKTTQVTQYLAEAGYTTKGK-IGCTQPRRVAAMSVAKRVAEEFGCRLGEEVGYAIRFEDCTGPD-TVIKY
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
