UniGene Name: sp_v3.0_unigene61675
Length: 211 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene61675
A |
Ace file of the UniGene sp_v3.0_unigene61675 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Putative ent-Kaurenoic acid hydroxylase-like cytochrome P450 n=1 Tax=Ginkgo biloba RepID=Q6J4H0_GINBI | - | - | 2.0e-23 | 70% |
FL-Next | tr=Cytochrome P450 90A20; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 43% |
Sma3 | Ent-kaurenoic acid oxidase | - | - | 1.189e-13 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ent-kaurenoic acid oxidase. | EC:1.14.13.79 | - | 1.319e-09 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Diterpenoid biosynthesis | 00904 | 1.319e-09 | % | |
Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 1.319e-09 | % | |
Sma3 | Biosynthesis of plant hormones | 01070 | 1.319e-09 | % | |
Sma3 | Metabolic pathways | 01100 | 1.319e-09 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.319e-09 | % |
Source | Gene names |
---|---|
Sma3 | At2g32440; CYP88A1; CYP88A2; CYP88A4; CYP88A8; CYP88A9; CYP88C1; D3; GPR5; GSVIVT00018965001; GSVIVT00018966001; KAO1; KAO2; LsKAO; OSJNBa0004I20.18; Os06g0110000; OsI_07000; OsJ_19857; P0514G12.42; POPTRDRAFT_571955; POPTRDRAFT_688380; RCOM_0659440; T32F |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | endoplasmic reticulum membrane | GO:0005789 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
Sma3 | ent-kaurenoate oxidase activity | GO:0051777 | Molecular Function | 0.0 | - |
Sma3 | gibberellin metabolic process | GO:0009685 | Biological Process | 0.0 | - |
Sma3 | gibberellin biosynthetic process | GO:0009686 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
Sma3 | Cytochrome P450, B-class | IPR002397 | - | 0.0 | - |
Sma3 | Cytochrome P450, E-class, group I | IPR002401 | - | 0.0 | - |
Sma3 | Cytochrome P450, E-class, group IV | IPR002403 | - | 0.0 | - |
Sma3 | EYA | IPR006545 | - | 0.0 | - |
Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
Sma3 | IPR017973 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G32440.1 | KAO2, CYP88A4, ATKAO2 ent-kaurenoic acid hydroxylase 2 chr2:13775668-13777783 FORWARD LENGTH=489 | 3.0e-26 | 62% |
RefSeq | Arabidopsis thaliana | NP_001189657.1 | Ent-kaurenoic acid oxidase 2 [Arabidopsis thaliana] | 4.0e-26 | 62% |
RefSeq | Populus trichocarpa | XP_002319447.1 | cytochrome P450 probable ent-kaurenoic acid oxidase [Populus trichocarpa] | 6.0e-26 | 62% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NWM7
Fln msg: Distance to subject end: 378 aas, your sequence is shorter than subject: 70 - 487
Fln protein:
P
Protein Length:
71
Fln nts:
A
Fln Alignment:
G5KS2UX02I94MP___PGDMGWPLLGNMLCFLRDFKSANPEAFISSFVSRFNRVGVYKAFMFGKPTILATTPEACRRVLMDD
A9NWM7_______________PGSMGWPLLGETLQLIAAYKTSNPEPFVDTRRSRYGK--VFKTHLFGKPTIFSTDPEVNKFILQNE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain