UniGene Name: sp_v3.0_unigene61547
Length: 225 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene61547
A |
Ace file of the UniGene sp_v3.0_unigene61547
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Os01g0804200 protein n=2 Tax=Oryza sativa Japonica Group RepID=Q0JIG1_ORYSJ | - | - | 5.0e-16 | 53% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 60% |
| Sma3 | Cytochrome P450 | - | - | 9.599e-16 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Unspecific monooxygenase. | EC:1.14.14.1 | - | 1.381e-07 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Fatty acid metabolism | 00071 | 1.381e-07 | % | |
| Sma3 | Steroid hormone biosynthesis | 00140 | 1.381e-07 | % | |
| Sma3 | Caffeine metabolism | 00232 | 1.381e-07 | % | |
| Sma3 | Tryptophan metabolism | 00380 | 1.381e-07 | % | |
| Sma3 | Arachidonic acid metabolism | 00590 | 1.381e-07 | % | |
| Sma3 | Linoleic acid metabolism | 00591 | 1.381e-07 | % | |
| Sma3 | Aminobenzoate degradation | 00627 | 1.381e-07 | % | |
| Sma3 | Retinol metabolism | 00830 | 1.381e-07 | % | |
| Sma3 | Metabolism of xenobiotics by cytochrome P450 | 00980 | 1.381e-07 | % | |
| Sma3 | Drug metabolism - cytochrome P450 | 00982 | 1.381e-07 | % | |
| Sma3 | Drug metabolism - other enzymes | 00983 | 1.381e-07 | % | |
| Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 1.381e-07 | % | |
| Sma3 | Metabolic pathways | 01100 | 1.381e-07 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g34540; At3g26125; At3g56630; At5g23190; CYP86A20; CYP86B4; CYP86B5; CYP86C5v1; CYP86C5v2; CYP86C6; CYP94D22; CYP94D23v1; CYP94D23v2; GSVIVT00030196001; GSVIVT00030724001; GSVIVT00031208001; LOC_Os10g34480; OSJNBa0029C15.3; Os10g0486100; OsI_34090; OsJ |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
| Sma3 | Cytochrome P450, E-class, group I | IPR002401 | - | 0.0 | - |
| Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
| Sma3 | IPR017973 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G26125.1 | CYP86C2 cytochrome P450, family 86, subfamily C, polypeptide 2 chr3:9551812-9553437 FORWARD LENGTH=541 | 5.0e-21 | 54% |
| RefSeq | Arabidopsis thaliana | NP_189243.1 | cytochrome P450, family 86, subfamily C, polypeptide 2 [Arabidopsis thaliana] | 7.0e-21 | 54% |
| RefSeq | Populus trichocarpa | XP_002333384.1 | cytochrome P450 [Populus trichocarpa] | 5.0e-20 | 58% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLC1
Fln msg: Distance to subject end: 135 aas, your sequence is shorter than subject: 74 - 528
Fln protein:
C
Protein Length:
75
Fln nts:
A
Fln Alignment:
G5KS2UX02HTHFF___VLAGRDTTSAALSWFFWLLMQHPDVEEKILLEIRRILNLSPSDNY--NSHKGFVAEDLKDMHYLHAALSETLRLY
B8LLC1_______________ILAGRDTTSVALSWFFWLLLQHPSVEDKIMEEIYSILEARPNQKQEGNDPVCFSKDELKQMHYLHACLSEAIRLY

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta