UniGene Name: sp_v3.0_unigene61542
Length: 200 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene61542
A |
Ace file of the UniGene sp_v3.0_unigene61542
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Putative phosphate transporter n=1 Tax=Cryptomeria japonica RepID=Q1XG57_CRYJA | - | - | 5.0e-13 | 79% |
| FL-Next | tr=Putative phosphate transporter; Cryptomeria japonica (Japanese cedar) (Cupressus japonica). | - | - | 0.0 | 79% |
| Sma3 | Phosphate transporter | - | - | 0.0 | - |
| Source | Gene names |
|---|---|
| Sma3 | APT1; APT2; At2g32830; At2g38940; At3g54700; At5g43340; At5g43350; At5g43360; At5g43370; EcPT1; EcPT2; EdPT1; F24L7.3; GSVIVT00006480001; GSVIVT00006481001; GSVIVT00020254001; GSVIVT00020255001; GSVIVT00020257001; GSVIVT00028600001; GSVIVT00028602001; GSV |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | plastid | GO:0009536 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
| Sma3 | transporter activity | GO:0005215 | Molecular Function | 0.0 | - |
| Sma3 | inorganic phosphate transmembrane transporter activity | GO:0005315 | Molecular Function | 0.0 | - |
| Sma3 | symporter activity | GO:0015293 | Molecular Function | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
| Sma3 | phosphate ion transport | GO:0006817 | Biological Process | 0.0 | - |
| Sma3 | cellular response to phosphate starvation | GO:0016036 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidase, cysteine peptidase active site | IPR000169 | - | 0.0 | - |
| Sma3 | WW/Rsp5/WWP | IPR001202 | - | 0.0 | - |
| Sma3 | AP2/ERF domain | IPR001471 | - | 0.0 | - |
| Sma3 | Carbohydrate/puine kinase, PfkB, conserved site | IPR002173 | - | 0.0 | - |
| Sma3 | Hydroxymethylglutaryl-CoA reductase, class I/II | IPR002202 | - | 0.0 | - |
| Sma3 | Phosphate permease | IPR004738 | - | 0.0 | - |
| Sma3 | General substrate transporter | IPR005828 | - | 0.0 | - |
| Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
| Sma3 | Serine/threonine-specific protein phosphatase/bis(5-nucleosyl)-tetraphosphatase | IPR006186 | - | 0.0 | - |
| Sma3 | Major facilitator superfamily | IPR011701 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G43350.1 | " ATPT1, PHT1;1 phosphate transporter 1;1 chr5:17399918-17401643 REVERSE LENGTH=524" | 2.0e-16 | 88% |
| RefSeq | Arabidopsis thaliana | NP_199149.1 | inorganic phosphate transporter 1-1 [Arabidopsis thaliana] | 3.0e-16 | 88% |
| RefSeq | Populus trichocarpa | XP_002300153.1 | high affinity inorganic phosphate transporter, partial [Populus trichocarpa] | 5.0e-16 | 72% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q1XG57
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 363 aas, your sequence is shorter than subject: 52 - 544
Fln protein:
M
Protein Length:
53
Fln nts:
A
Fln Alignment:
G5KS2UX02H1D90___MSFGHTAKSVMTTLCFFRFWLGFGIGGDYPLSATLRRARIKRR
Q1XG57_______________LSFGHTAKSVMTTLCFFRFWLGFGIGGDYPLSATIMSEYANKR

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta