SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene61531

Length: 300 nt

UniGene Fasta

>sp_v3.0_unigene61531
AATGTGATATCTACGACAACGAGTACAAGTCCGAGTTCGAGAAGCTTGGCATCTGGTACGAGCACCGTCTCATTGATGACATGGTTGCGCAGATGATCAAGAGCGAGGGAGGCTATATCATTGCTATGAAGAACTACGATGGAGACGTGCAGTCAGACATTGTAGCCCAGGGCTTTGGCAGCCTGGGACTGATGACTTCGGTCCTGATCACGCCTGACGGCAAGACGTTCGAGGCTGAGGCTGCACACGGTACTGTGACACGACACTTCCGAGAGCACCAAAAGGGAACCCAACCTCGAC

Ace file of the UniGene sp_v3.0_unigene61531

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Isocitrate dehydrogenase [NADP] n=1 Tax=Phaeosphaeria nodorum SN15 RepID=Q0V3G8_PHANO	-	-	4.06377e-44	88%
FL-Next	sp=Isocitrate dehydrogenase [NADP]; Pinus pinaster (Maritime pine).	-	-	0.0	76%
Sma3	Isocitrate dehydrogenase	-	-	1.934e-13	-

Source	ECs	Term	Type	e value	Identity
Sma3	Isocitrate dehydrogenase (NADP(+)).	EC:1.1.1.42	-	2.461e-15	-

Source	KEGGs	Term	e value	Identity
Sma3	Citrate cycle (TCA cycle)	00020	2.461e-15	%
Sma3	Glutathione metabolism	00480	2.461e-15	%
Sma3	Carbon fixation pathways in prokaryotes	00720	2.461e-15	%
Sma3	Biosynthesis of phenylpropanoids	01061	2.461e-15	%
Sma3	Biosynthesis of terpenoids and steroids	01062	2.461e-15	%
Sma3	Biosynthesis of alkaloids derived from shikimate pathway	01063	2.461e-15	%
Sma3	Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid	01064	2.461e-15	%
Sma3	Biosynthesis of alkaloids derived from histidine and purine	01065	2.461e-15	%
Sma3	Biosynthesis of alkaloids derived from terpenoid and polyketide	01066	2.461e-15	%
Sma3	Biosynthesis of plant hormones	01070	2.461e-15	%
Sma3	Metabolic pathways	01100	2.461e-15	%
Sma3	Biosynthesis of secondary metabolites	01110	2.461e-15	%

Source	Gene names
Sma3	At1g54340; At1g65930; At5g14590; CHLREDRAFT_196567; DcNADP-ICDH1; DcNADP-ICDH2; EgICDH; F20D21.16; GSVIVT00002132001; GSVIVT00020702001; GSVIVT00023479001; ICDH; ICDH-1; ICDH-2; IDH; IDH1; IDH3; LaICDH1; LaICDH2; OJ1735_C10.15; OSIGBa0101P20.6; OSJNBa0043

Source	GOs	Term	Type	Identity
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	mitochondrion	GO:0005739	Cellular Component	-
Sma3	peroxisome	GO:0005777	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	apoplast	GO:0048046	Cellular Component	-
Sma3	magnesium ion binding	GO:0000287	Molecular Function	-
Sma3	isocitrate dehydrogenase (NAD+) activity	GO:0004449	Molecular Function	-
Sma3	isocitrate dehydrogenase (NADP+) activity	GO:0004450	Molecular Function	-
Sma3	manganese ion binding	GO:0030145	Molecular Function	-
Sma3	NAD binding	GO:0051287	Molecular Function	-
Sma3	glyoxylate cycle	GO:0006097	Biological Process	-
Sma3	tricarboxylic acid cycle	GO:0006099	Biological Process	-
Sma3	isocitrate metabolic process	GO:0006102	Biological Process	-
Sma3	oxidation-reduction process	GO:0055114	Biological Process	-

Source	InterPros	Term	Type	e value	Identity
Sma3	Isocitrate/isopropylmalate dehydrogenase	IPR001804	-	0.0	-
Sma3	Isocitrate dehydrogenase NADP-dependent, eukaryotic-type	IPR004790	-	0.0	-

Source	Species	ID	Description	Identity
ATG	Arabidoptis thaliana	AT1G65930.1	cICDH cytosolic NADP+-dependent isocitrate dehydrogenase chr1:24539088-24541861 FORWARD LENGTH=410	75%
RefSeq	Arabidopsis thaliana	NP_176768.1	isocitrate dehydrogenase [Arabidopsis thaliana]	75%
RefSeq	Populus trichocarpa	XP_002315093.1	predicted protein [Populus trichocarpa]	76%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: A0AR16

Fln msg: Distance to subject end: 89 aas, your sequence is shorter than subject: 99 - 417

Fln protein: CDIYDNEYKSEFEKLGIWYEHRLIDDMVAQMIKSEGGYIIAMKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFEAEAAHGTVTRHFREHQKGTQPR

Protein Length: 100

Fln nts: AATGTGATATCTACGACAACGAGTACAAGTCCGAGTTCGAGAAGCTTGGCATCTGGTACGAGCACCGTCTCATTGATGACATGGTTGCGCAGATGATCAAGAGCGAGGGAGGCTATATCATTGCTATGAAGAACTACGATGGAGACGTGCAGTCAGACATTGTAGCCCAGGGCTTTGGCAGCCTGGGACTGATGACTTCGGTCCTGATCACGCCTGACGGCAAGACGTTCGAGGCTGAGGCTGCACACGGTACTGTGACACGACACTTCCGAGAGCACCAAAAGGGAACCCAACCTCGAC

Fln Alignment:

G5KS2UX02JCI7O___DIYDNEYKSEFEKLGIWYEHRLIDDMVAQMIKSEGGYIIAMKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFEAEAAHGTVTRHFREHQKG
A0AR16_______________EVYESNWKSKYEKAGIWYEHRLIDDMVAYALKSEGGYVWACKNYDGDVQSDFLAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYRVHQKG

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain