|
||||||
|
UniGene Name: sp_v3.0_unigene61398
Length: 236 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene61398
A |
|
Ace file of the UniGene sp_v3.0_unigene61398
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Xyloglucan endotransglucosylase/hydrolase n=1 Tax=Sagittaria pygmaea RepID=Q4LET4_9LILI | - | - | 2.0e-23 | 62% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 77% |
| Sma3 | Xyloglucan endotransglycosylase | - | - | 4.53e-39 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Xyloglucan:xyloglucosyl transferase. | EC:2.4.1.207 | - | 0.0 | - |
| Source | Gene names |
|---|---|
| Sma3 | 19-1-5; AoXET1; AoXET2; At3g23730; At4g03210; At4g14130; At4g25810; At4g25820; At4g28850; At4g30270; At4g37800; At5g13870; At5g57530; At5g57540; At5g57550; At5g57560; At5g65730; BR1; EXGT; EXGT-A4; EXGT-A5; EXGT-A6; EXT; F14M19.100; F14M19.90; F16A16.40; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | hydrolase activity, hydrolyzing O-glycosyl compounds | GO:0004553 | Molecular Function | 0.0 | - |
| Sma3 | xyloglucan:xyloglucosyl transferase activity | GO:0016762 | Molecular Function | 0.0 | - |
| Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
| Sma3 | cellular glucan metabolic process | GO:0006073 | Biological Process | 0.0 | - |
| Sma3 | cellular cell wall organization | GO:0007047 | Biological Process | 0.0 | - |
| Sma3 | response to heat | GO:0009408 | Biological Process | 0.0 | - |
| Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
| Sma3 | response to mechanical stimulus | GO:0009612 | Biological Process | 0.0 | - |
| Sma3 | plant-type cell wall organization | GO:0009664 | Biological Process | 0.0 | - |
| Sma3 | response to auxin stimulus | GO:0009733 | Biological Process | 0.0 | - |
| Sma3 | response to brassinosteroid stimulus | GO:0009741 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycoside hydrolase, family 16 | IPR000757 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, family 16, active site | IPR008263 | - | 0.0 | - |
| Sma3 | Beta-glucanase | IPR008264 | - | 0.0 | - |
| Sma3 | Xyloglucan endo-transglycosylase, C-terminal | IPR010713 | - | 0.0 | - |
| Sma3 | Concanavalin A-like lectin/glucanase, subgroup | IPR013320 | - | 0.0 | - |
| Sma3 | Xyloglucan endotransglucosylase/hydrolase | IPR016455 | - | 0.0 | - |
| Sma3 | Carbohydrate kinase, FGGY, conserved site | IPR018483 | - | 0.0 | - |
| Sma3 | DNA topoisomerase, type IIA, conserved site | IPR018522 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G23730.1 | XTH16 xyloglucan endotransglucosylase/hydrolase 16 chr3:8550222-8551248 FORWARD LENGTH=291 | 3.0e-28 | 60% |
| RefSeq | Arabidopsis thaliana | NP_566738.1 | xyloglucan:xyloglucosyl transferase [Arabidopsis thaliana] | 4.0e-28 | 60% |
| RefSeq | Populus trichocarpa | XP_002324481.1 | predicted protein, partial [Populus trichocarpa] | 2.0e-29 | 62% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NTM6
Fln msg: Distance to subject end: 154 aas, your sequence is shorter than subject: 78 - 290
Fln protein:
N
Protein Length:
79
Fln nts:
A
Fln Alignment:
G5KS2UX02GS8ON___VDRSSGSGFQSINQYIFGSVSVAIKLVPGNSAGTVTSYYMSSEGSWHDELDIEFLGNQSGMPLDLQTNIFANGVGGR
A9NTM6_______________MDKASGSGFQSINQYLFGSVSVGIKLVSGNSAGTVTSYYMSSEGSFHDELDFEFLGNLPGKPYVLQTNVFGSGVGNR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
