UniGene Name: sp_v3.0_unigene61387
Length: 205 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene61387
A |
Ace file of the UniGene sp_v3.0_unigene61387
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Heat shock protein (Fragment) n=1 Tax=Picea mariana RepID=O65069_PICMA | - | - | 6.0e-25 | 88% |
| FL-Next | tr=GRP94; Pinus taeda (Loblolly pine). | - | - | 0.0 | 56% |
| Sma3 | Heat shock protein 90 | - | - | 0.0 | - |
| Source | Gene names |
|---|---|
| Sma3 | At5g52640; At5g56000; At5g56010; At5g56030; CHLREDRAFT_138117; GSVIVT00002550001; GSVIVT00004280001; GSVIVT00037726001; HSC80; HSP81-1; HSP81-2; HSP81-3; HSP81.2; HSP82; HSP83; HSP83A; HSP90; HSP90-1; HSP90-2; HSP90A; Hsp90; JS851; JS852; LOC_Os09g30438; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | unfolded protein binding | GO:0051082 | Molecular Function | 0.0 | - |
| Sma3 | protein folding | GO:0006457 | Biological Process | 0.0 | - |
| Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
| Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
| Sma3 | response to water deprivation | GO:0009414 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | flower development | GO:0009908 | Biological Process | 0.0 | - |
| Sma3 | heat acclimation | GO:0010286 | Biological Process | 0.0 | - |
| Sma3 | leaf development | GO:0048366 | Biological Process | 0.0 | - |
| Sma3 | protein stabilization | GO:0050821 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Heat shock protein Hsp90 | IPR001404 | - | 0.0 | - |
| Sma3 | ATPase-like, ATP-binding domain | IPR003594 | - | 0.0 | - |
| Sma3 | Late embryogenesis abundant protein, LEA-18 | IPR018930 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G52640.1 | HSP81-1, ATHS83, HSP81.1, HSP83, ATHSP90.1, AtHsp90-1, HSP90.1 heat shock protein 90.1 chr5:21352542-21355147 FORWARD LENGTH=705 | 2.0e-28 | 80% |
| RefSeq | Arabidopsis thaliana | NP_200076.1 | heat shock protein 81-1 [Arabidopsis thaliana] | 2.0e-28 | 80% |
| RefSeq | Populus trichocarpa | XP_002300303.1 | predicted protein [Populus trichocarpa] | 4.0e-29 | 83% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A7YAU9
Fln msg: Distance to subject end: 533 aas, your sequence is shorter than subject: 68 - 834
Fln protein:
N
Protein Length:
69
Fln nts:
A
Fln Alignment:
G5KS2UX02GJBOB___VPETTSGEVLGSLGTKITLLLKDDQLEYLEERRLKDLIKKHSEFISYPISLWTEKTTEKEVSDDEE
A7YAU9_______________VSEDTENEPLGR-GTEIRLHLKDEASEYLDETKLKDLVKKYSEFINFPIYLWASKEVDVEVPADEE

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta