UniGene Name: sp_v3.0_unigene61293
Length: 209 nt
![]() |
---|
>sp_v3.0_unigene61293
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Lipoxygenase n=1 Tax=Picea sitchensis RepID=B8LLK5_PICSI | - | - | 2.0e-22 | 70% |
FL-Next | sp=Lipoxygenase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 70% |
Sma3 | Lipoxygenase | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Lipoxygenase. | EC:1.13.11.12 | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Linoleic acid metabolism | 00591 | 0.0 | % | |
Sma3 | alpha-Linolenic acid metabolism | 00592 | 0.0 | % | |
Sma3 | Biosynthesis of plant hormones | 01070 | 0.0 | % | |
Sma3 | Metabolic pathways | 01100 | 0.0 | % |
Source | Gene names |
---|---|
Sma3 | ACRE44; GSVIVT00022800001; GSVIVT00022801001; GSVIVT00024673001; GSVIVT00024682001; LOC_Os03g49350; LOX; LOX1; LOX1.1; LOX1.2; LOX1.3; LOX1.4; LOX10; LOX2; LOX3; LOX4; LOX9; LOXA; LOXB; Lox; Lox1; Lox1:Ps:1; Lox1a; Lox1b; Lox1c; Lox2; Lox3; LoxB; LoxG; Lo |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
Sma3 | lipoxygenase activity | GO:0016165 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen | GO:0016702 | Molecular Function | 0.0 | - |
Sma3 | metal ion binding | GO:0046872 | Molecular Function | 0.0 | - |
Sma3 | oxylipin biosynthetic process | GO:0031408 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase M14, carboxypeptidase A | IPR000834 | - | 0.0 | - |
Sma3 | Lipoxygenase | IPR000907 | - | 0.0 | - |
Sma3 | Lipoxygenase, LH2 | IPR001024 | - | 0.0 | - |
Sma3 | Lipoxygenase, plant | IPR001246 | - | 0.0 | - |
Sma3 | Short-chain dehydrogenase/reductase SDR | IPR002198 | - | 0.0 | - |
Sma3 | Lipoxygenase, C-terminal | IPR013819 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G55020.1 | LOX1, ATLOX1 lipoxygenase 1 chr1:20525798-20530143 FORWARD LENGTH=859 | 3.0e-18 | 59% |
RefSeq | Arabidopsis thaliana | NP_175900.1 | lipoxygenase 1 [Arabidopsis thaliana] | 4.0e-18 | 59% |
RefSeq | Populus trichocarpa | XP_002319014.1 | predicted protein [Populus trichocarpa] | 7.0e-21 | 66% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLK5
Fln msg: Distance to subject end: 209 aas, your sequence is shorter than subject: 69 - 930
Fln protein:
C
Protein Length:
70
Fln nts:
A
Fln Alignment:
G5KS2UX02G7RV5___TKIGSLTNKDCRFS------DLLKRGMAVRDPTSPYGLKLVIQDYPYAVDGLDIWFTLKQWVSDYLSLYYKDDA
B8LLK5_______________TEMSSKIYKEWKFNEQGLPADLLKRGMAVRNPTSPYGLKLVIEDYPYAVDGLEIWLSLKEWVSDYLSLYYKDDA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain