UniGene Name: sp_v3.0_unigene61234
Length: 121 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene61234
T |
Ace file of the UniGene sp_v3.0_unigene61234 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Reversibly glycosylated protein n=2 Tax=Phaseoleae RepID=Q69F96_PHAVU | - | - | 5.0e-11 | 86% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 92% |
Sma3 | Reversibly glycosylated polypeptide | - | - | 1.788e-14 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Transferases, Glycosyltransferases, Hexosyltransferases. | EC:2.4.1.- | - | 1.017e-08 | - |
Source | Gene names |
---|---|
Sma3 | 8C01; At3g02230; At3g08900; At3g08900/T16O11_16; At5g15650; At5g50750; AtRGP; BA12; CHLREDRAFT_187866; EZY11; F14F8_30; F14P3.12; GRPL1; GRPL2; GSVIVT00000015001; GSVIVT00017950001; GSVIVT00030012001; GSVIVT00038072001; LOC_Os03g40270; OJ1523_A02.1; OSJNB |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
Sma3 | Golgi apparatus | GO:0005794 | Cellular Component | 0.0 | - |
Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
Sma3 | cytosolic ribosome | GO:0022626 | Cellular Component | 0.0 | - |
Sma3 | cell junction | GO:0030054 | Cellular Component | 0.0 | - |
Sma3 | transferase activity, transferring hexosyl groups | GO:0016758 | Molecular Function | 0.0 | - |
Sma3 | GO:0047210 | Molecular Function | 0.0 | - | |
Sma3 | cellular cell wall organization | GO:0007047 | Biological Process | 0.0 | - |
Sma3 | cellulose biosynthetic process | GO:0030244 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Alpha-1,4-glucan-protein synthase, UDP-forming | IPR004901 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G02230.1 | RGP1, ATRGP1 reversibly glycosylated polypeptide 1 chr3:415463-417304 FORWARD LENGTH=357 | 4.0e-16 | 86% |
RefSeq | Arabidopsis thaliana | NP_186872.1 | reversibly glycosylated polypeptide 1 [Arabidopsis thaliana] | 5.0e-16 | 86% |
RefSeq | Populus trichocarpa | XP_002330919.1 | predicted protein [Populus trichocarpa] | 3.0e-16 | 86% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NKS5
Fln msg: Distance to subject end: 170 aas, your sequence is shorter than subject: 39 - 363
Fln protein:
S
Protein Length:
40
Fln nts:
T
Fln Alignment:
G5KS2UX02HOK8W___SLRHGISTAVSHGLWMNIPDYDAPTQKLVKPLERNTRY
A9NKS5_______________SLRHGTPTAVSHGLWMNIPDYDAPTQ-LVKPLERNTRY
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain