SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene61210

Length: 195 nt

UniGene Fasta

>sp_v3.0_unigene61210
AATGTAAATGAACACAGAGCTTTCCGAATACGTCATTTGCAAAAGTGATCCGATGCCAGAGTCGCTGACGGATTACGACACAGAGCCTGCCCACATGACGCTTCACAGGTTTGGGAATACTTCCTCCAGTGGGCTCTGGTATCAGGTGGCCTACATGGAGGCCAAGGGGCGGATGAAGAAAGGTGACCGCCTGTG

Ace file of the UniGene sp_v3.0_unigene61210

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	3-ketoacyl-CoA synthase n=1 Tax=Ricinus communis RepID=B9T7E3_RICCO	-	-	6.0e-12	74%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	72%
Sma3	Beta-ketoacyl-coa synthase family protein	-	-	1.128e-26	-

Source	ECs	Term	Type	e value	Identity
Sma3	Transferases, Acyltransferases, Transferring groups other than amino-acyl groups.	EC:2.3.1.-	-	6.412e-23	-

Source	KEGGs	Term	Type	e value	Identity
Sma3	Fatty acid biosynthesis	00061		6.412e-23	%
Sma3	Tetracycline biosynthesis	00253		6.412e-23	%
Sma3	Lysine degradation	00310		6.412e-23	%
Sma3	Arginine and proline metabolism	00330		6.412e-23	%
Sma3	Histidine metabolism	00340		6.412e-23	%
Sma3	Tyrosine metabolism	00350		6.412e-23	%
Sma3	Benzoate degradation	00362		6.412e-23	%
Sma3	Lipopolysaccharide biosynthesis	00540		6.412e-23	%
Sma3	Glycerophospholipid metabolism	00564		6.412e-23	%
Sma3	Ether lipid metabolism	00565		6.412e-23	%
Sma3	Glycosphingolipid biosynthesis - ganglio series	00604		6.412e-23	%
Sma3	Toluene degradation	00623		6.412e-23	%
Sma3	Naphthalene degradation	00626		6.412e-23	%
Sma3	Aminobenzoate degradation	00627		6.412e-23	%
Sma3	Ethylbenzene degradation	00642		6.412e-23	%
Sma3	Butanoate metabolism	00650		6.412e-23	%
Sma3	Methane metabolism	00680		6.412e-23	%
Sma3	Limonene and pinene degradation	00903		6.412e-23	%
Sma3	Diterpenoid biosynthesis	00904		6.412e-23	%
Sma3	Carotenoid biosynthesis	00906		6.412e-23	%
Sma3	Anthocyanin biosynthesis	00942		6.412e-23	%
Sma3	Stilbenoid, diarylheptanoid and gingerol biosynthesis	00945		6.412e-23	%
Sma3	Isoquinoline alkaloid biosynthesis	00950		6.412e-23	%
Sma3	Tropane, piperidine and pyridine alkaloid biosynthesis	00960		6.412e-23	%
Sma3	Betalain biosynthesis	00965		6.412e-23	%
Sma3	Biosynthesis of unsaturated fatty acids	01040		6.412e-23	%
Sma3	Biosynthesis of type II polyketide backbone	01056		6.412e-23	%
Sma3	Biosynthesis of terpenoids and steroids	01062		6.412e-23	%
Sma3	Metabolic pathways	01100		6.412e-23	%
Sma3	Biosynthesis of secondary metabolites	01110		6.412e-23	%
Sma3	Icosanoyl-CoA synthase.	EC:2.3.1.119	-	1.571e-06	-

Source	Gene names
Sma3	AT1G01120; At1g01120; At1g04220; At1g07720; At2g26640; At2g28630; At2g46720; At3g10280; At4g34250; At5g04530; At5g43760; At5g49070; CM0216.300.nc; EL1; EL2; F10M10.20; F14P13.12; F18A8.1; F20D22.1; F24B9.18; GSVIVT00005393001; GSVIVT00014607001; GSVIVT000

Source	GOs	Term	Type	Identity
Sma3	endoplasmic reticulum	GO:0005783	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	cytosolic ribosome	GO:0022626	Cellular Component	-
Sma3		GO:0008415	Molecular Function	-
Sma3	fatty acid elongase activity	GO:0009922	Molecular Function	-
Sma3	transferase activity, transferring acyl groups other than amino-acyl groups	GO:0016747	Molecular Function	-
Sma3	icosanoyl-CoA synthase activity	GO:0033807	Molecular Function	-
Sma3	fatty acid biosynthetic process	GO:0006633	Biological Process	-
Sma3	response to osmotic stress	GO:0006970	Biological Process	-
Sma3	response to cold	GO:0009409	Biological Process	-
Sma3	response to light stimulus	GO:0009416	Biological Process	-
Sma3	response to wounding	GO:0009611	Biological Process	-
Sma3	wax biosynthetic process	GO:0010025	Biological Process	-
Sma3	suberin biosynthetic process	GO:0010345	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	TonB box, conserved site	IPR010916	-	-
Sma3	Chalcone/stilbene synthase, C-terminal	IPR012328	-	-
Sma3	Very-long-chain 3-ketoacyl-CoA synthase	IPR012392	-	-
Sma3	FAE1/Type III polyketide synthase-like protein	IPR013601	-	-
Sma3	3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C-terminal	IPR013747	-	-
Sma3	Thiolase-like, subgroup	IPR016038	-	-
Sma3	Ribosomal protein S10, conserved site	IPR018268	-	-
Sma3	WD40 repeat, conserved site	IPR019775	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT2G28630.1	KCS12 3-ketoacyl-CoA synthase 12 chr2:12275719-12277149 REVERSE LENGTH=476	5.0e-16	72%
RefSeq	Arabidopsis thaliana	NP_180431.1	3-ketoacyl-CoA synthase 12 [Arabidopsis thaliana]	6.0e-16	72%
RefSeq	Populus trichocarpa	XP_002334321.1	predicted protein [Populus trichocarpa]	2.0e-16	69%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: D5A7W7

Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 58 aas, your sequence is shorter than subject: 64 - 305

Fln protein: M*MNTELSEYVICKSDPMPESLTDYDTEPAHMTLHRFGNTSSSGLWYQVAYMEAKGRMKKGDRL

Protein Length: 65

Fln nts: AATGTAAATGAACACAGAGCTTTCCGAATACGTCATTTGCAAAAGTGATCCGATGCCAGAGTCGCTGACGGATTACGACACAGAGCCTGCCCACATGACGCTTCACAGGTTTGGGAATACTTCCTCCAGTGGGCTCTGGTATCAGGTGGCCTACATGGAGGCCAAGGGGCGGATGAAGAAAGGTGACCGCCTGTG

Fln Alignment:

G5KS2UX02F68QR___LTDYDTEPAHMTLHRFGNTSSSGLWYQVAYMEAKGRMKKGDRL
D5A7W7_______________LSDYDLEPSRMALHRFGNTSTSGLWYEVAYLEAKRRFKVGDRV

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain