UniGene Name: sp_v3.0_unigene61125
Length: 115 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene61125
T |
Ace file of the UniGene sp_v3.0_unigene61125 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | heat shock protein 70 [Oryza sativa Indica Group] | - | - | 1.0e-08 | 96% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 96% |
Sma3 | Heat shock protein 70 | - | - | 1.337e-16 | - |
Source | Gene names |
---|---|
Sma3 | At1g16030; At1g56410; At3g09440; At3g12580; At5g02490; At5g02500; At5g28540; At5g42020; BIP1; BIP2; BIP4; BIP5; BLP4; BiP; Bip; CHLREDRAFT_133650; CHLREDRAFT_133859; F11F8; F13N6.9; F3L24.33; GSVIVT00018481001; GSVIVT00021301001; GSVIVT00022731001; GSVIVT |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
Sma3 | endoplasmic reticulum lumen | GO:0005788 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | cytosolic ribosome | GO:0022626 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
Sma3 | response to heat | GO:0009408 | Biological Process | 0.0 | - |
Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
Sma3 | response to virus | GO:0009615 | Biological Process | 0.0 | - |
Sma3 | response to bacterium | GO:0009617 | Biological Process | 0.0 | - |
Sma3 | response to high light intensity | GO:0009644 | Biological Process | 0.0 | - |
Sma3 | response to hydrogen peroxide | GO:0042542 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Heat shock protein Hsp70 | IPR001023 | - | 0.0 | - |
Sma3 | Heat shock protein 70 | IPR013126 | - | 0.0 | - |
Sma3 | Heat shock protein 70, conserved site | IPR018181 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G09440.1 | Heat shock protein 70 (Hsp 70) family protein chr3:2903434-2905632 REVERSE LENGTH=649 | 8.0e-13 | 96% |
RefSeq | Arabidopsis thaliana | NP_001189847.1 | protein heat shock protein 70-3 [Arabidopsis thaliana] | 1.0e-12 | 96% |
RefSeq | Populus trichocarpa | XP_002332589.1 | predicted protein [Populus trichocarpa] | 1.0e-12 | 96% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LRY5
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 483 aas, your sequence is shorter than subject: 38 - 652
Fln protein:
L
Protein Length:
39
Fln nts:
T
Fln Alignment:
G5KS2UX02H39AV___AYLGTTIKNAVVTVPAYFNDSQRQKATKDAGVI
B8LRY5_______________AYLGTTIKNAVVTVPAYFNDSQRQ-ATKDAGVI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain