UniGene Name: sp_v3.0_unigene61124
Length: 172 nt
![]() |
---|
>sp_v3.0_unigene61124
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | glycolate oxidase [Solanum lycopersicum] | - | - | 3.0e-15 | 83% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 79% |
Sma3 | Glycolate oxidase | - | - | 2.16e-26 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Transferred entry: 1.1.3.15. | EC:1.1.3.1 | - | 5.169e-08 | - |
Sma3 | (S)-2-hydroxy-acid oxidase. | EC:1.1.3.15 | - | 7.281e-18 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glyoxylate and dicarboxylate metabolism | 00630 | 7.281e-18 | % | |
Sma3 | Metabolic pathways | 01100 | 7.281e-18 | % |
Source | Gene names |
---|---|
Sma3 | AT4g18360; At3g14130; At3g14415; At3g14420; At4g18360; B1056G08.112; B1364A02.33-1; F28J12.20; GLO; GOX; GSVIVT00000984001; GSVIVT00028321001; GSVIVT00034039001; GSVIVT00034041001; H0215F08.7; H0215F08.8; LOC_Os03g57220; LeGLO2; MAO2.2; MLN21.20; OSJNBa00 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | peroxisome | GO:0005777 | Cellular Component | 0.0 | - |
Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | (S)-2-hydroxy-acid oxidase activity | GO:0003973 | Molecular Function | 0.0 | - |
Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
Sma3 | FMN binding | GO:0010181 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | oxidative photosynthetic carbon pathway | GO:0009854 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | FMN-dependent dehydrogenase | IPR000262 | - | 0.0 | - |
Sma3 | FMN-dependent alpha-hydroxy acid dehydrogenase, active site | IPR008259 | - | 0.0 | - |
Sma3 | Alpha-hydroxy acid dehydrogenase, FMN-dependent | IPR012133 | - | 0.0 | - |
Sma3 | Aldolase-type TIM barrel | IPR013785 | - | 0.0 | - |
Sma3 | IPR017934 | - | 0.0 | - | |
Sma3 | HTH domain AraC-type, conserved site | IPR018062 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G18360.1 | Aldolase-type TIM barrel family protein chr4:10146141-10148386 REVERSE LENGTH=368 | 2.0e-19 | 77% |
RefSeq | Arabidopsis thaliana | NP_001078406.1 | (S)-2-hydroxy-acid oxidase [Arabidopsis thaliana] | 1.0e-19 | 77% |
RefSeq | Populus trichocarpa | XP_002330746.1 | predicted protein [Populus trichocarpa] | 7.0e-21 | 83% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LPP7
Fln msg: Distance to subject end: 197 aas, your sequence is shorter than subject: 56 - 367
Fln protein:
C
Protein Length:
57
Fln nts:
A
Fln Alignment:
G5KS2UX02F4PQT___SSTGQGIRFFL*LYVLKDRYVVAQLVRRAENAGFKAIVLTVDTPRLGRREADIR
B8LPP7_______________ASTGPGIRFFQ-LYVYKNRHVVEQLVRRAERAGFKAIALTVDTPRLGRREADIK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain