UniGene Name: sp_v3.0_unigene61092
Length: 152 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene61092
A |
Ace file of the UniGene sp_v3.0_unigene61092
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Sucrose synthase n=1 Tax=Pinus taeda RepID=A6N837_PINTA | - | - | 5.0e-18 | 89% |
| FL-Next | tr=Sucrose synthase; Pinus taeda (Loblolly pine). | - | - | 0.0 | 89% |
| Sma3 | Sucrose synthase | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Sucrose synthase. | EC:2.4.1.13 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Starch and sucrose metabolism | 00500 | 0.0 | % | |
| Sma3 | Metabolic pathways | 01100 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g73370; At3g43190; At4g02280; At5g20830; At5g49190; B1056G08.118; BoSS; CSS1; CitSS2; CitSUS1; CitSUS1-2; CitSUSA; CitSUSA-2; F7K15_40; FaSS; GSVIVT00000882001; GSVIVT00003157001; GSVIVT00016378001; GSVIVT00023450001; GSVIVT00026116001; GSVIVT000280360 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | GTP binding | GO:0005525 | Molecular Function | 0.0 | - |
| Sma3 | sucrose synthase activity | GO:0016157 | Molecular Function | 0.0 | - |
| Sma3 | sucrose-phosphate synthase activity | GO:0046524 | Molecular Function | 0.0 | - |
| Sma3 | response to hypoxia | GO:0001666 | Biological Process | 0.0 | - |
| Sma3 | sucrose metabolic process | GO:0005985 | Biological Process | 0.0 | - |
| Sma3 | response to osmotic stress | GO:0006970 | Biological Process | 0.0 | - |
| Sma3 | biosynthetic process | GO:0009058 | Biological Process | 0.0 | - |
| Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
| Sma3 | response to flooding | GO:0009413 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Sucrose synthase | IPR000368 | - | 0.0 | - |
| Sma3 | Glycosyl transferase, family 1 | IPR001296 | - | 0.0 | - |
| Sma3 | DNA methylase, N-6 adenine-specific, conserved site | IPR002052 | - | 0.0 | - |
| Sma3 | Small GTPase superfamily, ARF/SAR type | IPR006689 | - | 0.0 | - |
| Sma3 | Sucrose synthase, plant/cyanobacteria | IPR012820 | - | 0.0 | - |
| Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
| Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G20830.1 | SUS1, ASUS1, atsus1 sucrose synthase 1 chr5:7050599-7054032 REVERSE LENGTH=808 | 4.0e-22 | 85% |
| RefSeq | Arabidopsis thaliana | NP_197583.1 | sucrose synthase 1 [Arabidopsis thaliana] | 5.0e-22 | 85% |
| RefSeq | Populus trichocarpa | XP_002326309.1 | hypothetical protein POPTRDRAFT_826368 [Populus trichocarpa] | 3.0e-22 | 85% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A6N837
Fln msg: Distance to subject end: 317 aas, your sequence is shorter than subject: 50 - 833
Fln protein:
C
Protein Length:
51
Fln nts:
A
Fln Alignment:
G5KS2UX02GXYHV___ILSMNHADFIITSTYQEIAGSKDTVGQYESHAAFTLPGLYRVIHGID
A6N837_______________LIAMNHADFIITSTYQEIAGSKDTVGQYESHTAFTLPGLYRVVHGID

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta