UniGene Name: sp_v3.0_unigene61053
Length: 213 nt
UniGene Fasta |
---|
>sp_v3.0_unigene61053
A |
Ace file of the UniGene sp_v3.0_unigene61053 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Pentatricopeptide repeat-containing protein, putative n=1 Tax=Ricinus communis RepID=B9STP1_RICCO | - | - | 7.0e-18 | 65% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 63% |
Sma3 | Pentatricopeptide (PPR) repeat-containing protein-like | - | - | 1.556e-11 | - |
Source | Gene names |
---|---|
Sma3 | At1g05750; At1g28690; At1g33350; At1g59720; At2g20540; At4g02750; At4g16470; F10C21.4; F1K23.11; F23H11.3; FCAALL.374; GSVIVT00006853001; GSVIVT00007101001; GSVIVT00007119001; GSVIVT00007171001; GSVIVT00013497001; GSVIVT00015057001; GSVIVT00016330001; GSV |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | mitochondrial inner membrane | GO:0005743 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
Sma3 | protein transporter activity | GO:0008565 | Molecular Function | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | protein transport | GO:0015031 | Biological Process | 0.0 | - |
Sma3 | RNA metabolic process | GO:0016070 | Biological Process | 0.0 | - |
Sma3 | mRNA modification | GO:0016556 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
Sma3 | Multi antimicrobial extrusion protein | IPR002528 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | Mitochondrial inner membrane translocase subunit Tim17/Tim22/Tim23/peroxisomal protein PMP24 | IPR003397 | - | 0.0 | - |
Sma3 | MIF4G-like, type 3 | IPR003890 | - | 0.0 | - |
Sma3 | Initiation factor eIF-4 gamma, MA3 | IPR003891 | - | 0.0 | - |
Sma3 | IPR008512 | - | 0.0 | - | |
Sma3 | TonB box, conserved site | IPR010916 | - | 0.0 | - |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | Methyltransferase type 11 | IPR013216 | - | 0.0 | - |
Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G59720.1 | CRR28 Tetratricopeptide repeat (TPR)-like superfamily protein chr1:21939868-21941784 REVERSE LENGTH=638 | 2.0e-22 | 59% |
RefSeq | Arabidopsis thaliana | NP_176180.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 3.0e-22 | 59% |
RefSeq | Populus trichocarpa | XP_002322762.1 | predicted protein [Populus trichocarpa] | 4.0e-22 | 60% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ADG9
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 214 aas, your sequence is shorter than subject: 71 - 312
Fln protein:
N
Protein Length:
72
Fln nts:
A
Fln Alignment:
G5KS2UX02JM01T___KMKQAGMKPNKITFTGLLSACSHGGLVDKGLQYFDCMCREYCITPAVEHYACIVDLLGRAGHLDSAYN
D5ADG9_______________QMQQRGVKPNEITFISVLSACSHAGLVDEGWKCYNCMTLDYAITPTVEHYACMVDLLGRAGHLNEAWD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain