UniGene Name: sp_v3.0_unigene61035
Length: 228 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene61035
T |
Ace file of the UniGene sp_v3.0_unigene61035 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Reverse transcriptase (Fragment) n=1 Tax=Taxus baccata RepID=Q56GF5_TAXBA | - | - | 3.0e-19 | 70% |
| FL-Next | sp=RNA-directed DNA polymerase homolog; berteroana). Mitochondrion. | - | - | 0.0 | 41% |
| Sma3 | Reverse transcriptase | - | - | 8.754e-11 | - |
| Source | Gene names |
|---|---|
| Sma3 | At2g05610; LOC_Os03g05350; LOC_Os03g30350; LOC_Os10g13960; LOC_Os10g28310; LOC_Os11g08610; OJ1004_F02.14; OSIGBa0118P15.5; OSJNBa0004B23.3; OSJNBa0004L19.22; OSJNBa0014J14.7; OSJNBa0053B21.11; OSJNBa0059D20.8; OSJNBa0067N01.10; OSJNBa0070D17.10; OSJNBb005 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
| Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
| Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Chromo domain/shadow | IPR000953 | - | 0.0 | - |
| Sma3 | Legume lectin, alpha chain, conserved site | IPR000985 | - | 0.0 | - |
| Sma3 | Legume lectin domain | IPR001220 | - | 0.0 | - |
| Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
| Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
| Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Peptidase aspartic, catalytic | IPR009007 | - | 0.0 | - |
| Sma3 | Retroviral aspartyl protease | IPR013242 | - | 0.0 | - |
| Sma3 | Concanavalin A-like lectin/glucanase, subgroup | IPR013320 | - | 0.0 | - |
| Sma3 | Zinc finger, H2C2-type, histone UAS binding | IPR015416 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - | |
| Sma3 | MULE transposase domain | IPR018289 | - | 0.0 | - |
Full-Lengther Next Prediction |
|---|
Fln status: Putative C-terminus
Fln database: sp_plants
Fln subject: P31843
Fln msg: query STOP codon is far from subject stop. Distance to subject end: 20 aas, your sequence is shorter than subject: 67 - 142
Fln protein:
Q
Protein Length:
68
Fln nts:
T
Fln Alignment:
G5KS2UX02JX48G___DISKTSFRCHYGHYEFLVMPFGLANTLAIFQSCMNHVFNKQLWKYLLLFFEDILIY
P31843_______________DEPKTTCVTRYGSFEFRVMPFGLTNALATFCNLMNNVLYEYLDHFVVVYLDDLVVY

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)