UniGene Name: sp_v3.0_unigene61032
Length: 156 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene61032
G |
Ace file of the UniGene sp_v3.0_unigene61032 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Abietadiene synthase, chloroplastic n=1 Tax=Abies grandis RepID=TPSDV_ABIGR | - | - | 2.0e-20 | 90% |
| FL-Next | tr=Levopimaradiene/abietadiene synthase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 92% |
| Sma3 | Copalyl diphosphate synthase | - | - | 5.369e-16 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Levopimaradiene synthase. | EC:4.2.3.32 | - | 1.264e-11 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Diterpenoid biosynthesis | 00904 | 1.264e-11 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.264e-11 | % | |
| Sma3 | Copalyl diphosphate synthase. | EC:5.5.1.12 | - | 6.788e-19 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Diterpenoid biosynthesis | 00904 | 6.788e-19 | % | |
| Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 6.788e-19 | % | |
| Sma3 | Metabolic pathways | 01100 | 6.788e-19 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 6.788e-19 | % |
| Source | Gene names |
|---|---|
| Sma3 | ABS; AG2.2; AG3.18; AG6.5; CPSL1; JF67; LPS; TASY; TDC1; TPS-Bis; TPS-ISO; TPS-LAS; TPS-Lim; TPS-Lin; TPS-Myr; TPS-Pin; TPS1; TPS2; TPS3; TPS4; TXS; TaCPS3; ac22; ag1; ag10; ag11; ag2; ag22; ag3; ag5; ag6; ag8; ag9; agc11; agc8; agc9; tasy; txs; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
| Sma3 | lyase activity | GO:0016829 | Molecular Function | 0.0 | - |
| Sma3 | carbon-oxygen lyase activity, acting on phosphates | GO:0016838 | Molecular Function | 0.0 | - |
| Sma3 | manganese ion binding | GO:0030145 | Molecular Function | 0.0 | - |
| Sma3 | (E)-beta-ocimene synthase activity | GO:0034768 | Molecular Function | 0.0 | - |
| Sma3 | pinene synthase activity | GO:0050550 | Molecular Function | 0.0 | - |
| Sma3 | myrcene synthase activity | GO:0050551 | Molecular Function | 0.0 | - |
| Sma3 | (4S)-limonene synthase activity | GO:0050552 | Molecular Function | 0.0 | - |
| Sma3 | abietadiene synthase activity | GO:0050554 | Molecular Function | 0.0 | - |
| Sma3 | copalyl diphosphate synthase activity | GO:0050559 | Molecular Function | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Prenyltransferase/squalene oxidase | IPR001330 | - | 0.0 | - |
| Sma3 | Terpene synthase-like | IPR001906 | - | 0.0 | - |
| Sma3 | Terpene synthase, metal-binding domain | IPR005630 | - | 0.0 | - |
| Sma3 | Terpenoid synthase | IPR008949 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G02780.1 | GA1, ABC33, ATCPS1, CPS, CPS1 Terpenoid cyclases/Protein prenyltransferases superfamily protein chr4:1237881-1244766 REVERSE LENGTH=802 | 1.0e-13 | 56% |
| RefSeq | Arabidopsis thaliana | NP_192187.1 | Ent-copalyl diphosphate synthase [Arabidopsis thaliana] | 2.0e-13 | 56% |
| RefSeq | Populus trichocarpa | XP_002306777.1 | copalyl diphosphate synthase [Populus trichocarpa] | 5.0e-12 | 50% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: F2XFB2
Fln msg: Distance to subject end: 473 aas, your sequence is shorter than subject: 51 - 859
Fln protein:
P
Protein Length:
52
Fln nts:
G
Fln Alignment:
G5KS2UX02IN7BT___PCQYPVDLFERLWSVDTVERLGIDRHFKEEIKDALDYVYSHWDEIRGIGW
F2XFB2_______________PCHYPLDLFERLWAVDTVERLGIDRHFKEEIKDALDYVYSHWDE-RGIGW

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)