UniGene Name: sp_v3.0_unigene61022
Length: 239 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene61022
A |
Ace file of the UniGene sp_v3.0_unigene61022 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Glutathione peroxidase n=1 Tax=Picea sitchensis RepID=A9NS67_PICSI | - | - | 9.0e-31 | 98% |
| FL-Next | sp=Glutathione peroxidase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 98% |
| Sma3 | Glutathione peroxidase | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phospholipid-hydroperoxide glutathione peroxidase. | EC:1.11.1.12 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glutathione metabolism | 00480 | 0.0 | % | |
| Sma3 | Glutathione peroxidase. | EC:1.11.1.9 | - | 1.175e-25 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glutathione metabolism | 00480 | 1.175e-25 | % | |
| Sma3 | Arachidonic acid metabolism | 00590 | 1.175e-25 | % |
| Source | Gene names |
|---|---|
| Sma3 | AP2_C11.1; At1g63460; At2g25080; At2g31570; At2g43350; At2g48150; At3g63080; At4g11600; At4g31870; BarPHGPX; CHLREDRAFT_143122; CHLREDRAFT_188373; CHLREDRAFT_206090; CSA; F11C18.70; F11L15.5; F13D4.40; F2K11.16; GP; GP1; GPX; GPX1; GPX2; GPX3; GPX4; GPX5; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast thylakoid membrane | GO:0009535 | Cellular Component | 0.0 | - |
| Sma3 | plastid | GO:0009536 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
| Sma3 | glutathione peroxidase activity | GO:0004602 | Molecular Function | 0.0 | - |
| Sma3 | selenium binding | GO:0008430 | Molecular Function | 0.0 | - |
| Sma3 | phospholipid-hydroperoxide glutathione peroxidase activity | GO:0047066 | Molecular Function | 0.0 | - |
| Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | abscisic acid mediated signaling pathway | GO:0009738 | Biological Process | 0.0 | - |
| Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
| Sma3 | response to hydrogen peroxide | GO:0042542 | Biological Process | 0.0 | - |
| Sma3 | cellular response to water deprivation | GO:0042631 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | PWWP | IPR000313 | - | 0.0 | - |
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Glutathione peroxidase | IPR000889 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
| Sma3 | RNA polymerase II, large subunit, CTD | IPR006569 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | IPR012335 | - | 0.0 | - | |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G31870.1 | ATGPX7, GPX7 glutathione peroxidase 7 chr4:15410205-15411617 FORWARD LENGTH=233 | 4.0e-28 | 75% |
| RefSeq | Arabidopsis thaliana | NP_194915.2 | glutathione peroxidase 7 [Arabidopsis thaliana] | 5.0e-28 | 75% |
| RefSeq | Populus trichocarpa | XP_002299536.1 | glutathione peroxidase [Populus trichocarpa] | 2.0e-30 | 80% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NS67
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 74 aas, your sequence is shorter than subject: 79 - 170
Fln protein:
S
Protein Length:
80
Fln nts:
A
Fln Alignment:
G5KS2UX02FMVLH___KVLLIVNVASQCGLTTSNYKELSEVYAKYKDQGLEILAFPCNQFGGQEPGDNAQIAEVACTR
A9NS67_______________KVLLIVNVASQCGLTNSNYKELSEVYAKYKDQGLEILAFPCNQFGGQEPGDNAQIAEVACTR

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)