UniGene Name: sp_v3.0_unigene60996
Length: 227 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene60996
N |
Ace file of the UniGene sp_v3.0_unigene60996 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Sucrose synthase n=1 Tax=Pinus halepensis RepID=Q5Y2E7_PINHA | - | - | 1.0e-31 | 98% |
| FL-Next | tr=Sucrose synthase; Pinus halepensis (Aleppo pine). | - | - | 0.0 | 98% |
| Sma3 | Sucrose synthase | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Sucrose synthase. | EC:2.4.1.13 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Starch and sucrose metabolism | 00500 | 0.0 | % | |
| Sma3 | Metabolic pathways | 01100 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g73370; At3g43190; At4g02280; At5g20830; At5g49190; B1056G08.118; CSS1; CitSUS1; CitSUS1-2; CitSUSA; CitSUSA-2; F7K15_40; GSVIVT00000882001; GSVIVT00016378001; GSVIVT00023450001; GSVIVT00028036001; GSVIVT00033041001; H0211A12.6; K21P3.6; LOC_Os03g22120 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | sucrose synthase activity | GO:0016157 | Molecular Function | 0.0 | - |
| Sma3 | transferase activity | GO:0016740 | Molecular Function | 0.0 | - |
| Sma3 | sucrose-phosphate synthase activity | GO:0046524 | Molecular Function | 0.0 | - |
| Sma3 | response to hypoxia | GO:0001666 | Biological Process | 0.0 | - |
| Sma3 | sucrose metabolic process | GO:0005985 | Biological Process | 0.0 | - |
| Sma3 | response to osmotic stress | GO:0006970 | Biological Process | 0.0 | - |
| Sma3 | biosynthetic process | GO:0009058 | Biological Process | 0.0 | - |
| Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
| Sma3 | response to flooding | GO:0009413 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Sucrose synthase | IPR000368 | - | 0.0 | - |
| Sma3 | Glycosyl transferase, family 1 | IPR001296 | - | 0.0 | - |
| Sma3 | DNA methylase, N-6 adenine-specific, conserved site | IPR002052 | - | 0.0 | - |
| Sma3 | Sucrose synthase, plant/cyanobacteria | IPR012820 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G20830.1 | SUS1, ASUS1, atsus1 sucrose synthase 1 chr5:7050599-7054032 REVERSE LENGTH=808 | 6.0e-26 | 86% |
| RefSeq | Arabidopsis thaliana | NP_197583.1 | sucrose synthase 1 [Arabidopsis thaliana] | 7.0e-26 | 86% |
| RefSeq | Populus trichocarpa | XP_002326309.1 | hypothetical protein POPTRDRAFT_826368 [Populus trichocarpa] | 1.0e-26 | 80% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q5Y2E7
Fln msg: Overlapping hits, possible frame ERROR between 161 and 154, Distance to subject end: 34 aas, your sequence is shorter than subject: 75 - 158
Fln protein:
G
Protein Length:
76
Fln nts:
t
Fln Alignment:
G5KS2UX02G6Y09___GLTVVEAMTCGLPTFATCNGGPAEIIVDGVSGFHIDPYHGDSASDRIADFxxRCKTDPSYWVKISDGGLQRIY
Q5Y2E7_______________GLTVVEAMTCGLPTFATCNGGPAEIIVDGVSGFHIDPYHGDSASDRIADFxxRCKTDPSYWVNISNGGLQRIY

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)