|
||||||
|
UniGene Name: sp_v3.0_unigene60984
Length: 247 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene60984
A |
|
Ace file of the UniGene sp_v3.0_unigene60984
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | putative protein kinase Xa21 [Oryza sativa Japonica Group] | - | - | 2.0e-21 | 58% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 47% |
| Sma3 | Serine-threonine protein kinase, plant-type, putative | - | - | 2.879e-12 | - |
| Source | Gene names |
|---|---|
| Sma3 | B1047H05.12; B1047H05.26; B1047H05.29; B1292H11.1; GSVIVT00002249001; GSVIVT00005204001; GSVIVT00012634001; GSVIVT00014285001; GSVIVT00014914001; GSVIVT00017170001; GSVIVT00018765001; GSVIVT00018767001; GSVIVT00021362001; GSVIVT00022825001; GSVIVT00022830 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Fumarate lyase | IPR000362 | - | 0.0 | - |
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat, typical subtype | IPR003591 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat-containing N-terminal, type 2 | IPR013210 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - | |
| Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, family 1, active site | IPR018120 | - | 0.0 | - |
| Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G47570.1 | Leucine-rich repeat protein kinase family protein chr3:17527611-17530748 FORWARD LENGTH=1010 | 3.0e-21 | 47% |
| RefSeq | Arabidopsis thaliana | NP_566892.1 | putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis thaliana] | 4.0e-21 | 47% |
| RefSeq | Populus trichocarpa | XP_002317696.1 | predicted protein [Populus trichocarpa] | 7.0e-25 | 52% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LPH3
Fln msg: Distance to subject end: 96 aas, your sequence is shorter than subject: 82 - 360
Fln protein:
M
Protein Length:
83
Fln nts:
A
Fln Alignment:
G5KS2UX02GGYT5___HHHCFVQVIHCDLKPKNVLLGEDMTSYIIDFGIATICFANSEHSAYTSTHALKGSIGYIPPEYGLGGRVTTKGDVYSYGI
B8LPH3_______________HHDCIPHIIHRDIKSSNILLDEEMEARISDFGLATLINPDQTH---VST-IVAGTFGYLAPEYVETGRATEKGDVYSYGV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
