SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene60977

Length: 136 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v3.0_unigene60977
ACCCAATGTTGTAAATTTGACTCTAATTGATCTCCCTGGGTTGACAAAAGTGGCTATTGACGGTCAACCTGAAAGTGTTGTTGCTGATATTGAGAACATGGTTCGAAACTCTTTCATTGAGAAGCCAAATTACATT

Ace file of the UniGene sp_v3.0_unigene60977 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Dynamin-related protein 1B n=2 Tax=Arabidopsis RepID=DRP1B_ARATH	-	-	2.0e-13	86%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	88%
Sma3	Dynamin, putative	-	-	2.258e-17	-

Source	Gene names
Sma3	ADL1; ADL1A; ADL1B; ADL1C; ADL1D; ADL1E; ADL4; ADL5; AG68; At1g14830; At2g44590; At3g60190; At3g61760; At5g42080; B1130E07.11; B1331F11.31; DLP1; DLP2; DLP3; DRP1A; DRP1B; DRP1C; DRP1D; DRP1E; F10B6.23; F15G16.150; F16B22.8; GSVIVT00006741001; GSVIVT00008

Source	GOs	Term	Type	Identity
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	mitochondrion	GO:0005739	Cellular Component	-
Sma3	vacuole	GO:0005773	Cellular Component	-
Sma3	microtubule	GO:0005874	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	cell cortex	GO:0005938	Cellular Component	-
Sma3	cell plate	GO:0009504	Cellular Component	-
Sma3	chloroplast thylakoid membrane	GO:0009535	Cellular Component	-
Sma3	motor activity	GO:0003774	Molecular Function	-
Sma3	GTPase activity	GO:0003924	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	GTP binding	GO:0005525	Molecular Function	-
Sma3	mitochondrial fission	GO:0000266	Biological Process	-
Sma3	cell cycle	GO:0007049	Biological Process	-
Sma3	embryo development ending in seed dormancy	GO:0009793	Biological Process	-
Sma3	cell plate formation involved in plant-type cell wall biogenesis	GO:0009920	Biological Process	-
Sma3	xylem and phloem pattern formation	GO:0010051	Biological Process	-
Sma3	trichome branching	GO:0010091	Biological Process	-
Sma3	pollen maturation	GO:0010152	Biological Process	-
Sma3	response to cadmium ion	GO:0046686	Biological Process	-
Sma3	defense response to fungus	GO:0050832	Biological Process	-
Sma3	cell division	GO:0051301	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Dynamin central domain	IPR000375	-	-
Sma3	Dynamin, GTPase domain	IPR001401	-	-
Sma3	Dynamin GTPase effector	IPR003130	-	-
Sma3	Dynamin, GTPase region, conserved site	IPR019762	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT3G61760.1	ADL1B, DL1B DYNAMIN-like 1B chr3:22860546-22864092 REVERSE LENGTH=610	1.0e-18	86%
RefSeq	Arabidopsis thaliana	NP_191735.2	dynamin-related protein 1B [Arabidopsis thaliana]	1.0e-18	86%
RefSeq	Populus trichocarpa	XP_002302631.1	predicted protein [Populus trichocarpa]	4.0e-18	86%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LLP8

Fln msg: Distance to subject end: 432 aas, your sequence is shorter than subject: 45 - 608

Fln protein: PNVVNLTLIDLPGLTKVAIDGQPESVVADIENMVRNSFIEKPNYI

Protein Length: 46

Fln nts: ACCCAATGTTGTAAATTTGACTCTAATTGATCTCCCTGGGTTGACAAAAGTGGCTATTGACGGTCAACCTGAAAGTGTTGTTGCTGATATTGAGAACATGGTTCGAAACTCTTTCATTGAGAAGCCAAATTACATT

Fln Alignment:

G5KS2UX02FVYE1___PNVVNLTLIDLPGLTKVAIDGQPESVVADIENMVRNSFIEKPNYI
B8LLP8_______________PNVVNLTLIDLPGLTKVAIEGQAESVVADIENMVR-SYIEKPNSI

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain