UniGene Name: sp_v3.0_unigene60914
Length: 130 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene60914
T |
Ace file of the UniGene sp_v3.0_unigene60914 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | HSP70 [Triticum aestivum] | - | - | 4.0e-10 | 88% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 94% |
Sma3 | Heat shock protein 70 | - | - | 8.483e-30 | - |
Source | Gene names |
---|---|
Sma3 | At1g16030; At1g56410; At3g09440; At3g12580; At5g02490; At5g02500; CHLREDRAFT_185673; F11F8; F13N6.9; F3L24.33; GSVIVT00018481001; GSVIVT00018506001; GSVIVT00021301001; GSVIVT00024351001; GSVIVT00024357001; HSC-2; HSC-I; HSC70; HSC70-1; HSC70-2; HSC70-3; H |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | cytosolic ribosome | GO:0022626 | Cellular Component | 0.0 | - |
Sma3 | nucleomorph | GO:0033009 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | ATPase activity, uncoupled | GO:0042624 | Molecular Function | 0.0 | - |
Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
Sma3 | response to heat | GO:0009408 | Biological Process | 0.0 | - |
Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
Sma3 | response to virus | GO:0009615 | Biological Process | 0.0 | - |
Sma3 | response to bacterium | GO:0009617 | Biological Process | 0.0 | - |
Sma3 | response to high light intensity | GO:0009644 | Biological Process | 0.0 | - |
Sma3 | response to hydrogen peroxide | GO:0042542 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Heat shock protein Hsp70 | IPR001023 | - | 0.0 | - |
Sma3 | Heat shock protein 70 | IPR013126 | - | 0.0 | - |
Sma3 | Heat shock protein 70, conserved site | IPR018181 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G02500.1 | HSC70-1, HSP70-1, AT-HSC70-1, HSC70 heat shock cognate protein 70-1 chr5:554055-556334 REVERSE LENGTH=651 | 1.0e-12 | 83% |
RefSeq | Arabidopsis thaliana | NP_001119156.1 | heat shock 70kDa protein 1/8 [Arabidopsis thaliana] | 1.0e-12 | 83% |
RefSeq | Populus trichocarpa | XP_002311161.1 | predicted protein [Populus trichocarpa] | 4.0e-13 | 83% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LRY5
Fln msg: Distance to subject end: 558 aas, your sequence is shorter than subject: 43 - 652
Fln protein:
D
Protein Length:
44
Fln nts:
T
Fln Alignment:
G5KS2UX02IH8PX___QNQVAMNPTNTVFDAKRLIGRRFSDPTVNQNDMKLW
B8LRY5_______________KNQVAMNPTNTVFDAKRLIGRRFSDPTV-QNDMKLW
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain