UniGene Name: sp_v3.0_unigene60891
Length: 144 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene60891
A |
Ace file of the UniGene sp_v3.0_unigene60891
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Rubrerythrin domain containing protein | - | - | 1.0e-07 | 38% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 100% |
| Sma3 | Mg-protoporphyrin IX monomethyl ester oxidative cyclase | - | - | 4.6e-25 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Magnesium-protoporphyrin IX monomethyl ester (oxidative) cyclase. | EC:1.14.13.81 | - | 4.666e-27 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Porphyrin and chlorophyll metabolism | 00860 | 4.666e-27 | % | |
| Sma3 | Metabolic pathways | 01100 | 4.666e-27 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 4.666e-27 | % |
| Source | Gene names |
|---|---|
| Sma3 | CHLREDRAFT_183476; CHLREDRAFT_205856; CRD1; CTH1; CTH1|CTH1B; GSVIVT00023347001; Grc000113; Heak293_Cp050; MICPUCDRAFT_49742; MICPUN_107081; OSTLU_47501; Os01g0279100; OsI_01397; OsJ_01305; Ot15g02810; P0003H10.2; P0025D05.31; PHYPADRAFT_146121; PHYPADRAF |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast thylakoid membrane | GO:0009535 | Cellular Component | 0.0 | - |
| Sma3 | thylakoid | GO:0009579 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast inner membrane | GO:0009706 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | metal ion binding | GO:0046872 | Molecular Function | 0.0 | - |
| Sma3 | transition metal ion binding | GO:0046914 | Molecular Function | 0.0 | - |
| Sma3 | magnesium-protoporphyrin IX monomethyl ester (oxidative) cyclase activity | GO:0048529 | Molecular Function | 0.0 | - |
| Sma3 | photosynthesis | GO:0015979 | Biological Process | 0.0 | - |
| Sma3 | chlorophyll biosynthetic process | GO:0015995 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Rubrerythrin | IPR003251 | - | 0.0 | - |
| Sma3 | Magnesium-protoporphyrin IX monomethyl ester aerobic oxidative cyclase | IPR008434 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G56940.1 | CRD1, CHL27, ACSF dicarboxylate diiron protein, putative (Crd1) chr3:21076594-21078269 FORWARD LENGTH=409 | 1.0e-15 | 100% |
| RefSeq | Arabidopsis thaliana | NP_001190112.1 | magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase [Arabidopsis thaliana] | 1.0e-15 | 100% |
| RefSeq | Populus trichocarpa | XP_002308846.1 | predicted protein [Populus trichocarpa] | 2.0e-15 | 100% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NUZ9
Fln msg: Distance to subject end: 234 aas, your sequence is shorter than subject: 47 - 431
Fln protein:
C
Protein Length:
48
Fln nts:
A
Fln Alignment:
G5KS2UX02HM0N5___AEFSGFLLYKELGRRLKKTNPVVAEIFSLMSRDE
A9NUZ9_______________AEFSGFLLYKELGRRLKKTNPVVAEIFSLMSRDE

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta