UniGene Name: sp_v3.0_unigene60858
Length: 116 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene60858
A |
Ace file of the UniGene sp_v3.0_unigene60858
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Glyceraldehyde-3-phosphate dehydrogenase (Fragment) n=3 Tax=Spermatophyta RepID=Q5TME3_PINTH | - | - | 6.0e-11 | 97% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 97% |
| Sma3 | Glyceraldehyde-3-phosphate dehydrogenase subunit A | - | - | 1.777e-33 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glyceraldehyde-3-phosphate dehydrogenase (NADP(+)) (phosphorylating). | EC:1.2.1.13 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Carbon fixation in photosynthetic organisms | 00710 | 0.0 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 0.0 | % | |
| Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 0.0 | % | |
| Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 0.0 | % | |
| Sma3 | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 0.0 | % | |
| Sma3 | Biosynthesis of alkaloids derived from histidine and purine | 01065 | 0.0 | % | |
| Sma3 | Biosynthesis of alkaloids derived from terpenoid and polyketide | 01066 | 0.0 | % | |
| Sma3 | Biosynthesis of plant hormones | 01070 | 0.0 | % | |
| Sma3 | Metabolic pathways | 01100 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | AT1G12900; At1g12900; At1g42970; CHLREDRAFT_129019; F13A11.3; F13K23.15; GAP3; GAPA; GAPB; GAPDH; GAPDH_3; GAPDH_5; GPA1; GPB1; GSVIVT00002909001; GSVIVT00006239001; GSVIVT00037996001; GapA; GapA1; GapA2; GapB; H0219H12.1; LOC_Os03g03720; MICPUCDRAFT_2533 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast thylakoid membrane | GO:0009535 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | argininosuccinate lyase activity | GO:0004056 | Molecular Function | 0.0 | - |
| Sma3 | glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity | GO:0004365 | Molecular Function | 0.0 | - |
| Sma3 | glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) activity | GO:0047100 | Molecular Function | 0.0 | - |
| Sma3 | NAD binding | GO:0051287 | Molecular Function | 0.0 | - |
| Sma3 | glucose metabolic process | GO:0006006 | Biological Process | 0.0 | - |
| Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
| Sma3 | response to light stimulus | GO:0009416 | Biological Process | 0.0 | - |
| Sma3 | response to sucrose stimulus | GO:0009744 | Biological Process | 0.0 | - |
| Sma3 | reductive pentose-phosphate cycle | GO:0019253 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | IPR000173 | - | 0.0 | - | |
| Sma3 | Domain of unknown function CP12 | IPR003823 | - | 0.0 | - |
| Sma3 | Glyceraldehyde-3-phosphate dehydrogenase, type I | IPR006424 | - | 0.0 | - |
| Sma3 | TonB box, conserved site | IPR010916 | - | 0.0 | - |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G26650.1 | GAPA, GAPA-1 glyceraldehyde 3-phosphate dehydrogenase A subunit chr3:9795226-9796848 FORWARD LENGTH=396 | 4.0e-16 | 97% |
| RefSeq | Arabidopsis thaliana | NP_001077529.1 | glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) [Arabidopsis thaliana] | 3.0e-16 | 97% |
| RefSeq | Populus trichocarpa | XP_002321065.1 | predicted protein [Populus trichocarpa] | 6.0e-16 | 97% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PQ61
Fln msg: Distance to subject end: 141 aas, your sequence is shorter than subject: 38 - 330
Fln protein:
M
Protein Length:
39
Fln nts:
A
Fln Alignment:
G5KS2UX02GCS4K___FVKVLDQKFGIIKGTFMTTTHSYTGDQRLLDASHRD
C0PQ61_______________FVKVLDQKFGIIKGT-MTTTHSYTGDQRLLDASHRD

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta