UniGene Name: sp_v3.0_unigene60684
Length: 190 nt
UniGene Fasta |
---|
>sp_v3.0_unigene60684
A |
Ace file of the UniGene sp_v3.0_unigene60684 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | pfam07714, Pkinase_Tyr, Protein tyrosine kinase | - | - | 6.0e-06 | 51% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 87% |
Sma3 | Chromosome undetermined scaffold_302, whole genome shotgun sequence | - | - | 2.28e-07 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Non-specific protein-tyrosine kinase. | EC:2.7.10.2 | - | 2.478e-06 | - |
Sma3 | Transferases, Transferring phosphorous-containing groups, Protein-serine/threonine kinases. | EC:2.7.11.- | - | 2.422e-33 | - |
Source | Gene names |
---|---|
Sma3 | AT4g00960; AT4g21370; A_TM018A10.18; A_TM018A10.19; At3g45860; At4g00960; At4g00970; At4g11530; At4g21230; At4g21370; At4g23130; At4g23140; At4g23150; At4g23160; At4g23180; At4g23190; At4g23230; At4g23270; At4g23280; At4g23310; At4g38830; CRK10; CRK11; CR |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | intrinsic to membrane | GO:0031224 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | transmembrane signaling receptor activity | GO:0004888 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | apoptotic process | GO:0006915 | Biological Process | 0.0 | - |
Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
Sma3 | signal transduction | GO:0007165 | Biological Process | 0.0 | - |
Sma3 | defense response to bacterium, incompatible interaction | GO:0009816 | Biological Process | 0.0 | - |
Sma3 | innate immune response | GO:0045087 | Biological Process | 0.0 | - |
Sma3 | recognition of pollen | GO:0048544 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G21230.1 | CRK27 cysteine-rich RLK (RECEPTOR-like protein kinase) 27 chr4:11319244-11321679 REVERSE LENGTH=642 | 5.0e-12 | 72% |
RefSeq | Arabidopsis thaliana | NP_193855.2 | cysteine-rich receptor-like protein kinase 27 [Arabidopsis thaliana] | 7.0e-12 | 72% |
RefSeq | Populus trichocarpa | XP_002317908.1 | predicted protein [Populus trichocarpa] | 1.0e-12 | 62% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NQB9
Fln msg: Distance to subject end: 105 aas, your sequence is shorter than subject: 63 - 290
Fln protein:
T
Protein Length:
64
Fln nts:
A
Fln Alignment:
F7QVD2L01EZ44V___TYGYMPPEYAMQGQLSVKADVYSFGVLVLEI
A9NQB9_______________TYGYMAPEYAMLGQLSVKADVYSFGVVLLEI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain