UniGene Name: sp_v3.0_unigene60500
Length: 204 nt
![]() |
---|
>sp_v3.0_unigene60500
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Heme oxygenase-1 n=1 Tax=Cucumis sativus RepID=E2JEI2_CUCSA | - | - | 6.0e-19 | 73% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 72% |
Sma3 | Heme oxygenase 1 | - | - | 1.039e-27 | - |
Source | Gene names |
---|---|
Sma3 | At1g58300; At1g69720; At2g26670; F19C14.8; GSVIVT00014766001; GSVIVT00016897001; HO1; HO1a; HO1b; HO3; HO4; HY1; Os06g0603000; OsI_23615; OsJ_21897; P0486H12.31; PHYPADRAFT_181226; PHYPADRAFT_218505; POPTRDRAFT_779760; POPTRDRAFT_819093; RCOM_0223730; RCO |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | heme oxygenase (decyclizing) activity | GO:0004392 | Molecular Function | 0.0 | - |
Sma3 | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | - |
Sma3 | Rho guanyl-nucleotide exchange factor activity | GO:0005089 | Molecular Function | 0.0 | - |
Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
Sma3 | heme oxidation | GO:0006788 | Biological Process | 0.0 | - |
Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
Sma3 | photoperiodism | GO:0009648 | Biological Process | 0.0 | - |
Sma3 | chloroplast-nucleus signaling pathway | GO:0010019 | Biological Process | 0.0 | - |
Sma3 | phytochromobilin biosynthetic process | GO:0010024 | Biological Process | 0.0 | - |
Sma3 | regulation of meristem growth | GO:0010075 | Biological Process | 0.0 | - |
Sma3 | inflorescence development | GO:0010229 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Plant peroxidase | IPR000823 | - | 0.0 | - |
Sma3 | Haem peroxidase, plant/fungal/bacterial | IPR002016 | - | 0.0 | - |
Sma3 | Haem oxygenase | IPR002051 | - | 0.0 | - |
Sma3 | Plant specific Rop nucleotide exchanger, PRONE | IPR005512 | - | 0.0 | - |
Sma3 | TonB box, conserved site | IPR010916 | - | 0.0 | - |
Sma3 | Haem oxygenase-like | IPR016053 | - | 0.0 | - |
Sma3 | Haem oxygenase-like, multi-helical | IPR016084 | - | 0.0 | - |
Sma3 | Haem oxygenase (decyclizing), plant | IPR016951 | - | 0.0 | - |
Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
Sma3 | Peroxidases heam-ligand binding site | IPR019793 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G26670.1 | HY1, ATHO1, HO1, TED4, GUN2, HY6 Plant haem oxygenase (decyclizing) family protein chr2:11341816-11343394 FORWARD LENGTH=282 | 2.0e-24 | 73% |
RefSeq | Arabidopsis thaliana | NP_001118392.1 | heme oxygenase 1 [Arabidopsis thaliana] | 2.0e-24 | 73% |
RefSeq | Populus trichocarpa | XP_002324655.1 | predicted protein [Populus trichocarpa] | 2.0e-22 | 71% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NV53
Fln msg: Distance to subject end: 78 aas, your sequence is shorter than subject: 68 - 323
Fln protein:
D
Protein Length:
69
Fln nts:
G
Fln Alignment:
F7QVD2L01BYLPW___RGQGHAIPDPRSPGKSYSKYLEKIAEKDPPAFICHFYNIYFAHNAGGQMIGRQVA
A9NV53_______________RQQGHIIPEPSSPGISYAKYLQELSEKDPPAFLCHFYNVYFAHTAGGRMIGRKVA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain