UniGene Name: sp_v3.0_unigene60453
Length: 172 nt
![]() |
---|
>sp_v3.0_unigene60453
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Helicase, C-terminal; Argonaute and Dicer protein, PAZ; Ribonuclease III, bacterial n=1 Tax=Medicago truncatula RepID=Q2HTA7_MEDTR | - | - | 4.0e-19 | 100% |
FL-Next | sp=Endoribonuclease Dicer homolog 1; Oryza sativa subsp. japonica (Rice). | - | - | 0.0 | 100% |
Sma3 | Dicer-like protein | - | - | 3.455e-10 | - |
Source | Gene names |
---|---|
Sma3 | At1g01040; CAF; DCL1a; DCL1b; DCL4; DCL903; DCL905; GSVIVT00005618001; GSVIVT00026189001; LOC_Os03g02970; MtrDRAFT_AC150443g32v2; OJ1705B08.11; OSIGBa0157K09-H0214G12.2; OSJNBb0065L13.5; Os03g0121800; OsI_09779; OsI_16596; OsJ_09217; OsJ_15421; PHYPADRAFT |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | nuclear dicing body | GO:0010445 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | double-stranded RNA binding | GO:0003725 | Molecular Function | 0.0 | - |
Sma3 | helicase activity | GO:0004386 | Molecular Function | 0.0 | - |
Sma3 | ribonuclease III activity | GO:0004525 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | ATP-dependent helicase activity | GO:0008026 | Molecular Function | 0.0 | - |
Sma3 | cytokinesis | GO:0000910 | Biological Process | 0.0 | - |
Sma3 | RNA processing | GO:0006396 | Biological Process | 0.0 | - |
Sma3 | virus induced gene silencing | GO:0009616 | Biological Process | 0.0 | - |
Sma3 | embryonic pattern specification | GO:0009880 | Biological Process | 0.0 | - |
Sma3 | flower development | GO:0009908 | Biological Process | 0.0 | - |
Sma3 | vegetative to reproductive phase transition of meristem | GO:0010228 | Biological Process | 0.0 | - |
Sma3 | production of ta-siRNAs involved in RNA interference | GO:0010267 | Biological Process | 0.0 | - |
Sma3 | production of lsiRNA involved in RNA interference | GO:0010599 | Biological Process | 0.0 | - |
Sma3 | primary miRNA processing | GO:0031053 | Biological Process | 0.0 | - |
Sma3 | mRNA cleavage involved in gene silencing by miRNA | GO:0035279 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
Sma3 | Protease inhibitor I4, serpin | IPR000215 | - | 0.0 | - |
Sma3 | Ribonuclease III domain | IPR000999 | - | 0.0 | - |
Sma3 | Double-stranded RNA-binding | IPR001159 | - | 0.0 | - |
Sma3 | Helicase, C-terminal | IPR001650 | - | 0.0 | - |
Sma3 | Argonaute/Dicer protein, PAZ | IPR003100 | - | 0.0 | - |
Sma3 | Dicer double-stranded RNA-binding fold | IPR005034 | - | 0.0 | - |
Sma3 | Helicase/UvrB domain | IPR006935 | - | 0.0 | - |
Sma3 | DNA/RNA helicase, DEAD/DEAH box type, N-terminal | IPR011545 | - | 0.0 | - |
Sma3 | Helicase, superfamily 1/2, ATP-binding domain | IPR014001 | - | 0.0 | - |
Sma3 | IPR014021 | - | 0.0 | - | |
Sma3 | Double-stranded RNA-binding-like | IPR014720 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G01040.2 | DCL1 dicer-like 1 chr1:23519-31079 FORWARD LENGTH=1910 | 1.0e-23 | 95% |
RefSeq | Arabidopsis thaliana | NP_171612.1 | endoribonuclease Dicer [Arabidopsis thaliana] | 1.0e-23 | 95% |
RefSeq | Populus trichocarpa | XP_002308384.1 | dicer-like protein [Populus trichocarpa] | 2.0e-14 | 64% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q8LMR2
Fln msg: Distance to subject end: 1131 aas, your sequence is shorter than subject: 57 - 1883
Fln protein:
F
Protein Length:
58
Fln nts:
T
Fln Alignment:
F7QVD2L01A3E0G___FRDGRVTLLVATSVAEEGLDIRQCNVVIRFDLAKTVLAYIQSRGRARKP
Q8LMR2_______________FRDGRVTLLVATSVAEEGLDIRQCNVVIRFDLAKTVLAYIQSRGRARKP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain