UniGene Name: sp_v3.0_unigene60445
Length: 171 nt
![]() |
---|
>sp_v3.0_unigene60445
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | RecName: Full=Cysteine-rich receptor-like protein kinase 14; Short=Cysteine-rich RLK14; Flags: Precursor | - | - | 1.0e-12 | 71% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 84% |
Sma3 | Chromosome undetermined scaffold_278, whole genome shotgun sequence | - | - | 1.789e-10 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Non-specific protein-tyrosine kinase. | EC:2.7.10.2 | - | 1.693e-09 | - |
Sma3 | Transferases, Transferring phosphorous-containing groups, Protein-serine/threonine kinases. | EC:2.7.11.- | - | 7.628e-33 | - |
Sma3 | Mitogen-activated protein kinase kinase kinase. | EC:2.7.11.25 | - | 3.132e-08 | - |
Source | Gene names |
---|---|
Sma3 | ARK3; AT4g00960; AT4g03230; AT4g11500; AT4g21370; A_TM018A10.19; Ark1; At1g11330; At1g61390; At1g61610; At1g65790; At1g65800; At4g00960; At4g03230; At4g05200; At4g11460; At4g11470; At4g11480; At4g11490; At4g11530; At4g21370; At4g21380; At4g23140; At4g2316 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | signal transducer activity | GO:0004871 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
Sma3 | response to light stimulus | GO:0009416 | Biological Process | 0.0 | - |
Sma3 | defense response to bacterium, incompatible interaction | GO:0009816 | Biological Process | 0.0 | - |
Sma3 | recognition of pollen | GO:0048544 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G23220.1 | CRK14 cysteine-rich RLK (RECEPTOR-like protein kinase) 14 chr4:12154091-12157091 REVERSE LENGTH=728 | 3.0e-17 | 71% |
RefSeq | Arabidopsis thaliana | NP_567680.4 | cysteine-rich receptor-like protein kinase 14 [Arabidopsis thaliana] | 4.0e-17 | 71% |
RefSeq | Populus trichocarpa | XP_002311515.1 | predicted protein, partial [Populus trichocarpa] | 1.0e-17 | 76% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLN9
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 63 aas, your sequence is shorter than subject: 47 - 565
Fln protein:
G
Protein Length:
48
Fln nts:
A
Fln Alignment:
F7QVD2L01AH649___RLDWQKRYSIILGVTRGLLYVHQDSHLWIIHRDIKASNILLDKNL
B8LLN9_______________QLDWQKRYSIILGITRGLLYLHEDSHLRIIHRDIKPHNILLDKNL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain