|
||||||
|
UniGene Name: sp_v3.0_unigene60203
Length: 166 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene60203
T |
|
Ace file of the UniGene sp_v3.0_unigene60203
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Cytokinin receptor 1 n=1 Tax=Physcomitrella patens RepID=Q27PX4_9BRYO | - | - | 2.0e-17 | 83% |
| FL-Next | sp=Histidine kinase 2; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 75% |
| Sma3 | Histidine kinase | - | - | 1.301e-28 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Histidine kinase. | EC:2.7.13.3 | - | 7.791e-07 | - |
| Source | Gene names |
|---|---|
| Sma3 | AHK2; AHK3; AHK4; At1g27320; At2g01830; At5g35750; CKR1; CRE1; CRE1A; CRE1B; CRE2; GSVIVT00002792001; GSVIVT00029130001; GSVIVT00030632001; HK1; HK2; HK3; HK3A; HK3B; LOC_Os03g50860; LOC_Os10g21810; OHK3; OHK3b; OHK4; OHK5; OSJNBa0073L01.1; Os02g0738400; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | two-component sensor activity | GO:0000155 | Molecular Function | 0.0 | - |
| Sma3 | two-component response regulator activity | GO:0000156 | Molecular Function | 0.0 | - |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | osmosensor activity | GO:0005034 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | cytokinin receptor activity | GO:0009884 | Molecular Function | 0.0 | - |
| Sma3 | identical protein binding | GO:0042802 | Molecular Function | 0.0 | - |
| Sma3 | two-component signal transduction system (phosphorelay) | GO:0000160 | Biological Process | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
| Sma3 | response to water deprivation | GO:0009414 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | cytokinin mediated signaling pathway | GO:0009736 | Biological Process | 0.0 | - |
| Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
| Sma3 | regulation of seed germination | GO:0010029 | Biological Process | 0.0 | - |
| Sma3 | leaf senescence | GO:0010150 | Biological Process | 0.0 | - |
| Sma3 | regulation of chlorophyll catabolic process | GO:0010271 | Biological Process | 0.0 | - |
| Sma3 | peptidyl-histidine phosphorylation | GO:0018106 | Biological Process | 0.0 | - |
| Sma3 | regulation of shoot development | GO:0048831 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Signal transduction response regulator, receiver domain | IPR001789 | - | 0.0 | - |
| Sma3 | ATPase-like, ATP-binding domain | IPR003594 | - | 0.0 | - |
| Sma3 | Signal transduction histidine kinase, subgroup 1, dimerisation/phosphoacceptor domain | IPR003661 | - | 0.0 | - |
| Sma3 | Signal transduction histidine kinase-related protein, C-terminal | IPR004358 | - | 0.0 | - |
| Sma3 | Signal transduction histidine kinase, core | IPR005467 | - | 0.0 | - |
| Sma3 | CHASE | IPR006189 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, family 5, conserved site | IPR018087 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G35750.1 | AHK2, HK2 histidine kinase 2 chr5:13911743-13916337 REVERSE LENGTH=1176 | 9.0e-22 | 75% |
| RefSeq | Arabidopsis thaliana | NP_568532.1 | histidine kinase 2 [Arabidopsis thaliana] | 1.0e-21 | 75% |
| RefSeq | Populus trichocarpa | XP_002321181.1 | histidine kinase cytokinin receptor [Populus trichocarpa] | 6.0e-20 | 77% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9C5U2
Fln msg: Distance to subject end: 705 aas, your sequence is shorter than subject: 54 - 1176
Fln protein:
L
Protein Length:
55
Fln nts:
T
Fln Alignment:
F7JJN6E01EESLH___LTSPFRLLESNHLGVVLTFAVYDTDLSPDATEEERIKATAGYLGGAFDVESLVE
Q9C5U2_______________LTSPFKLLKSNHLGVVLTFAVYDTSLPPDATEEQRVEATIGYLGASYDMPSLVE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
